BLASTX nr result
ID: Glycyrrhiza33_contig00005820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00005820 (489 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK48113.1 unknown [Medicago truncatula] 79 7e-17 XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus caro... 76 1e-15 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 76 1e-15 XP_003626135.2 low temperature and salt responsive family protei... 75 2e-15 XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume... 75 3e-15 XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus pe... 76 4e-15 XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria ve... 75 5e-15 XP_008246326.1 PREDICTED: hydrophobic protein LTI6B-like [Prunus... 74 6e-15 ADK27677.1 plasma membrane protein 3-2 [Salvia miltiorrhiza] 74 8e-15 XP_018463798.1 PREDICTED: hydrophobic protein RCI2B-like [Raphan... 74 9e-15 XP_007207409.1 hypothetical protein PRUPE_ppa014548mg [Prunus pe... 74 9e-15 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 74 1e-14 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 73 2e-14 XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema s... 73 2e-14 XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema s... 75 2e-14 XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassi... 73 2e-14 NP_187239.1 Low temperature and salt responsive protein family [... 73 2e-14 XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bre... 72 3e-14 XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer ariet... 72 3e-14 XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sa... 72 3e-14 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 79.3 bits (194), Expect = 7e-17 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +2 Query: 29 HSYLCRHHRGHPPPSSRCLPQVWLPRGVLDLFGAYPSWISSWNYLCYLYHHQVI 190 H Y C HH PPSSRCLPQVWLP GVL LFG P W+S WN LCYL ++QVI Sbjct: 2 HRYHCCHH----PPSSRCLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVI 51 >XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus carota subsp. sativus] KZM96817.1 hypothetical protein DCAR_015821 [Daucus carota subsp. sativus] Length = 56 Score = 76.3 bits (186), Expect = 1e-15 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 21 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 K GTATF+DII+AI+LPPLGVFLKFGCHVEFWICL+LT Sbjct: 2 KEGTATFIDIILAIILPPLGVFLKFGCHVEFWICLLLT 39 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 75.9 bits (185), Expect = 1e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MG+ATFVDIIVAILLPPLGVFLKFGC VEFWICLVLT Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLT 37 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 75.5 bits (184), Expect = 2e-15 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTAT +DIIVAI+LPPLGVFLKFGCHVEFW+CLVLT Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLT 37 >XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume] ONI04114.1 hypothetical protein PRUPE_6G303600 [Prunus persica] Length = 54 Score = 75.1 bits (183), Expect = 3e-15 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTATFVDII+AILLPPLGVFLKFGC EFWICL+LT Sbjct: 1 MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILT 37 >XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 75.9 bits (185), Expect = 4e-15 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 21 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 +MGTATFVDII+AILLPPLGVFLKFGC EFWICL+LT Sbjct: 39 RMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILT 76 >XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria vesca subsp. vesca] Length = 57 Score = 74.7 bits (182), Expect = 5e-15 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 27 GTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 GTA F+DII+AILLPPLGVFLKFGCHVEFWICL+LT Sbjct: 5 GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLT 40 >XP_008246326.1 PREDICTED: hydrophobic protein LTI6B-like [Prunus mume] Length = 57 Score = 74.3 bits (181), Expect = 6e-15 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 27 GTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 GTA FVDI++AILLPPLGVFLKFGCHVEFWICL+LT Sbjct: 5 GTANFVDILIAILLPPLGVFLKFGCHVEFWICLLLT 40 >ADK27677.1 plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 73.9 bits (180), Expect = 8e-15 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTATF+DII+AILLPPLGVFLKFGC EFWICL+LT Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILT 37 >XP_018463798.1 PREDICTED: hydrophobic protein RCI2B-like [Raphanus sativus] Length = 55 Score = 73.9 bits (180), Expect = 9e-15 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTATFV+I++AILLPPLGVFLKFGC+VEFWICL+LT Sbjct: 1 MGTATFVEILLAILLPPLGVFLKFGCNVEFWICLILT 37 >XP_007207409.1 hypothetical protein PRUPE_ppa014548mg [Prunus persica] ONI04115.1 hypothetical protein PRUPE_6G303700 [Prunus persica] Length = 57 Score = 73.9 bits (180), Expect = 9e-15 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 27 GTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 GTA F+DI++AILLPPLGVFLKFGCHVEFWICL+LT Sbjct: 5 GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLT 40 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 73.6 bits (179), Expect = 1e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTAT VDII+AILLPPLGVFL+FGCH EFWICLVLT Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLT 37 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 73.2 bits (178), Expect = 2e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTAT +DII+AILLPPLGVFL+FGCH EFWICLVLT Sbjct: 1 MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLT 37 >XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] ESQ49469.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 73.2 bits (178), Expect = 2e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTATF+DI++AILLPPLGVFL+FGC VEFWICLVLT Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLT 37 >XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] ESQ49468.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 74.7 bits (182), Expect = 2e-14 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 21 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 KMGTATFV+II+AI+LPPLGVFLKFGC +EFWICL+LT Sbjct: 56 KMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILT 93 >XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica rapa] XP_013624669.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica oleracea var. oleracea] XP_013647899.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_013725411.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_018441126.1 PREDICTED: hydrophobic protein RCI2B-like [Raphanus sativus] Length = 54 Score = 72.8 bits (177), Expect = 2e-14 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTATF+DI++AILLPPLGVFL++GC VEFWICLVLT Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCEVEFWICLVLT 37 >NP_187239.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNQ7.1 RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A AAF26090.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAK50619.1 hydrophobic protein RCI2A [Arabidopsis thaliana] AAC97512.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAD17302.1 hydrophobic protein [Arabidopsis thaliana] AAK59845.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAK63963.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAL76128.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AEE74311.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP02097.1 RCI2A [Arabidopsis thaliana] Length = 54 Score = 72.8 bits (177), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 M TATFVDII+AILLPPLGVFL+FGC VEFWICLVLT Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLT 37 >XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] XP_009366022.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 72.4 bits (176), Expect = 3e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTAT +DII+AILLPPLGVFL+FGCH EFWICLVLT Sbjct: 1 MGTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLT 37 >XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 72.4 bits (176), Expect = 3e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 MGTAT VDII+AI+LPPLGVFLKFGC+VEFWICL+LT Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019093498.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091986.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091987.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] AFK81273.1 rare cold-inducible protein 2A [Camelina sativa] AFK81275.1 rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 72.4 bits (176), Expect = 3e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 24 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLT 134 M TATFVDII+A+LLPPLGVFL+FGC VEFWICLVLT Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLT 37