BLASTX nr result
ID: Glycyrrhiza33_contig00005819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00005819 (599 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK48113.1 unknown [Medicago truncatula] 69 1e-12 CBI39675.3 unnamed protein product, partial [Vitis vinifera] 68 2e-11 XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [... 64 3e-09 KCW44804.1 hypothetical protein EUGRSUZ_L01633, partial [Eucalyp... 61 7e-09 KCW82305.1 hypothetical protein EUGRSUZ_C03713 [Eucalyptus grandis] 61 1e-08 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 59 2e-08 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 58 2e-08 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 58 4e-08 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 57 5e-08 XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglan... 57 7e-08 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 57 7e-08 XP_003626135.2 low temperature and salt responsive family protei... 57 9e-08 XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus cl... 57 1e-07 XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radia... 56 1e-07 XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium r... 55 3e-07 KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] 55 3e-07 XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossyp... 55 3e-07 XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus ... 55 3e-07 XP_003536025.1 PREDICTED: hydrophobic protein RCI2B [Glycine max... 55 5e-07 ACU14681.1 unknown [Glycine max] 55 5e-07 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 69.3 bits (168), Expect = 1e-12 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 99 CLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLIN 227 CLPQVWLP GVL LFG +PFW+ WN LCYLC++QVI L ++ Sbjct: 15 CLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVINLAFVD 57 >CBI39675.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 68.2 bits (165), Expect = 2e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 96 WCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 209 WCLPQVW+P GVLDLFGA F + SWN LC LCHHQVI Sbjct: 60 WCLPQVWMPGGVLDLFGADFFRLPSWNCLCCLCHHQVI 97 >XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 64.3 bits (155), Expect = 3e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 93 TWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 209 +W LPQVWLP G+LDLF A W++ W++LC+LCHHQV+ Sbjct: 138 SWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQVM 176 >KCW44804.1 hypothetical protein EUGRSUZ_L01633, partial [Eucalyptus grandis] Length = 117 Score = 61.2 bits (147), Expect = 7e-09 Identities = 31/51 (60%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Frame = +1 Query: 13 VKRERG--RMAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 VKRE+G +MA EGT C GVFLKFGC VEFWICLVLTLF Sbjct: 52 VKREKGTGKMADEGTMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 102 >KCW82305.1 hypothetical protein EUGRSUZ_C03713 [Eucalyptus grandis] Length = 142 Score = 61.2 bits (147), Expect = 1e-08 Identities = 31/51 (60%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Frame = +1 Query: 13 VKRERG--RMAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 VKRE+G +MA EGT C GVFLKFGC VEFWICLVLTLF Sbjct: 77 VKREKGTGKMADEGTMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 127 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGTA C GVFLKFGCHVEFWICLVLT F Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFF 42 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 58.2 bits (139), Expect = 2e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 43 EGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 EGTATC GVFLK+GCHVEFWICLVLTLF Sbjct: 3 EGTATCIDILLAIILPPLGVFLKYGCHVEFWICLVLTLF 41 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGTATC GVFLKFGC VEFWICL+LTLF Sbjct: 1 MASEGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLF 42 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 57.4 bits (137), Expect = 5e-08 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGTA C GVFLKFGC+VEFWICLVLTLF Sbjct: 1 MADEGTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLTLF 42 >XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 57.0 bits (136), Expect = 7e-08 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGTATC GVFLKFGC VEFWICL+LT+F Sbjct: 1 MADEGTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLTIF 42 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 57.0 bits (136), Expect = 7e-08 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGT TC GVFLKFGC VEFWICLVLTLF Sbjct: 1 MADEGTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLTLF 42 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 56.6 bits (135), Expect = 9e-08 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 46 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 GTATC GVFLKFGCHVEFW+CLVLTLF Sbjct: 2 GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF 39 >XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006428347.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006480340.1 PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] ESR41586.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] ESR41587.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] KDO56401.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] KDO56402.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA EGTATC GVFLKFGC VEFWICL+LT+F Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIF 42 >XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] XP_017413861.1 PREDICTED: hydrophobic protein RCI2B [Vigna angularis] KOM35416.1 hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA +GTATC GVFLK+GC VEFWICLVLTLF Sbjct: 1 MAGDGTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF 42 >XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] XP_016667936.1 PREDICTED: hydrophobic protein RCI2B [Gossypium hirsutum] KJB82717.1 hypothetical protein B456_013G210800 [Gossypium raimondii] KJB82718.1 hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA + TATC GVFLKFGC VEFWICLVLTLF Sbjct: 1 MADDSTATCVDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42 >KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] Length = 57 Score = 55.5 bits (132), Expect = 3e-07 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = +3 Query: 129 VLDLFGAHPFWVYSWNHLCYLCHHQVI 209 +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 14 ILDLFGAYPFWLHSWNYLCCLCYHQVI 40 >XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossypium hirsutum] XP_017618304.1 PREDICTED: hydrophobic protein RCI2B [Gossypium arboreum] KHG20782.1 Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA + TATC GVFLKFGC VEFWICLVLTLF Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42 >XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 M EGT C GVFLKFGCHVEFWICL+LTLF Sbjct: 1 MPSEGTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLTLF 42 >XP_003536025.1 PREDICTED: hydrophobic protein RCI2B [Glycine max] KHN24195.1 Hydrophobic protein LTI6A [Glycine soja] KRH33736.1 hypothetical protein GLYMA_10G142700 [Glycine max] Length = 57 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA +G ATC GVFLK+GC VEFWICLVLTLF Sbjct: 1 MAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF 42 >ACU14681.1 unknown [Glycine max] Length = 57 Score = 54.7 bits (130), Expect = 5e-07 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +1 Query: 34 MAREGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 159 MA +G ATC GVFLK+GC VEFWICLVLTLF Sbjct: 1 MAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF 42