BLASTX nr result
ID: Glycyrrhiza33_contig00005742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00005742 (602 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003526506.1 PREDICTED: nuclear poly(A) polymerase 4 isoform X... 57 5e-06 >XP_003526506.1 PREDICTED: nuclear poly(A) polymerase 4 isoform X2 [Glycine max] KRH52804.1 hypothetical protein GLYMA_06G088500 [Glycine max] Length = 732 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 602 DHVPSASTQNLNCEMSDSEVLYKLKMGLGG 513 D+VP+AS+QNLNCEMS SEVLYKLKMGLGG Sbjct: 703 DYVPNASSQNLNCEMSVSEVLYKLKMGLGG 732