BLASTX nr result
ID: Glycyrrhiza33_contig00005556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00005556 (565 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] 58 1e-06 >GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] Length = 483 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -3 Query: 443 GPKISHL-FADDLLLTGEASMQQMEVVKDVLDRFCSHSGSEDQFSQAR 303 GPK+SH+ FADDL+L EA+M+Q+ ++KDVLD FCS+SG + +++R Sbjct: 374 GPKVSHICFADDLVLVAEANMEQVILIKDVLDSFCSNSGQQINLNKSR 421