BLASTX nr result
ID: Glycyrrhiza33_contig00004708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00004708 (758 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003523208.1 PREDICTED: small nuclear ribonucleoprotein E [Gly... 173 3e-52 XP_003542280.1 PREDICTED: small nuclear ribonucleoprotein E [Gly... 173 4e-52 XP_003597961.1 small nuclear ribonucleoprotein [Medicago truncat... 172 8e-52 ACU15277.1 unknown [Glycine max] 172 1e-51 XP_002522808.1 PREDICTED: small nuclear ribonucleoprotein E [Ric... 171 2e-51 XP_007154805.1 hypothetical protein PHAVU_003G149400g [Phaseolus... 171 2e-51 XP_004139778.1 PREDICTED: small nuclear ribonucleoprotein E [Cuc... 171 2e-51 XP_014497376.1 PREDICTED: small nuclear ribonucleoprotein E-like... 171 2e-51 XP_004490635.1 PREDICTED: small nuclear ribonucleoprotein E-like... 171 2e-51 XP_003549500.1 PREDICTED: small nuclear ribonucleoprotein E [Gly... 171 2e-51 XP_009606254.1 PREDICTED: small nuclear ribonucleoprotein E-like... 171 3e-51 ACJ83970.1 unknown [Medicago truncatula] AFK48337.1 unknown [Med... 171 3e-51 XP_018820851.1 PREDICTED: small nuclear ribonucleoprotein E-like... 170 5e-51 XP_015948775.1 PREDICTED: small nuclear ribonucleoprotein E-like... 170 5e-51 XP_002531748.2 PREDICTED: small nuclear ribonucleoprotein E [Ric... 170 5e-51 XP_017409631.1 PREDICTED: small nuclear ribonucleoprotein E-like... 170 6e-51 XP_012477072.1 PREDICTED: small nuclear ribonucleoprotein E-like... 170 6e-51 XP_007137755.1 hypothetical protein PHAVU_009G153200g [Phaseolus... 170 6e-51 XP_016578180.1 PREDICTED: small nuclear ribonucleoprotein E-like... 169 9e-51 XP_017981974.1 PREDICTED: small nuclear ribonucleoprotein E [The... 169 9e-51 >XP_003523208.1 PREDICTED: small nuclear ribonucleoprotein E [Glycine max] XP_003526883.1 PREDICTED: small nuclear ribonucleoprotein E [Glycine max] XP_004491225.1 PREDICTED: small nuclear ribonucleoprotein E-like [Cicer arietinum] XP_019442203.1 PREDICTED: small nuclear ribonucleoprotein E-like isoform X1 [Lupinus angustifolius] XP_019454008.1 PREDICTED: small nuclear ribonucleoprotein E-like [Lupinus angustifolius] XP_019436197.1 PREDICTED: small nuclear ribonucleoprotein E-like isoform X1 [Lupinus angustifolius] AFK38926.1 unknown [Lotus japonicus] KRH53956.1 hypothetical protein GLYMA_06G157100 [Glycine max] KRH63981.1 hypothetical protein GLYMA_04G208600 [Glycine max] OIW18657.1 hypothetical protein TanjilG_13409 [Lupinus angustifolius] OIW19447.1 hypothetical protein TanjilG_09467 [Lupinus angustifolius] Length = 88 Score = 173 bits (439), Expect = 3e-52 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMNTGK 88 >XP_003542280.1 PREDICTED: small nuclear ribonucleoprotein E [Glycine max] ACU14300.1 unknown [Glycine max] KHN34786.1 Small nuclear ribonucleoprotein E [Glycine soja] KRH18975.1 hypothetical protein GLYMA_13G093400 [Glycine max] Length = 88 Score = 173 bits (438), Expect = 4e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 N+KKKSRKTLGRILLKGDNITLMMNTGK Sbjct: 61 NIKKKSRKTLGRILLKGDNITLMMNTGK 88 >XP_003597961.1 small nuclear ribonucleoprotein [Medicago truncatula] XP_003615807.1 small nuclear ribonucleoprotein [Medicago truncatula] XP_019463643.1 PREDICTED: small nuclear ribonucleoprotein E-like [Lupinus angustifolius] AES68212.1 small nuclear ribonucleoprotein [Medicago truncatula] AES98765.1 small nuclear ribonucleoprotein [Medicago truncatula] AFK37227.1 unknown [Medicago truncatula] Length = 88 Score = 172 bits (436), Expect = 8e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKS+KTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSKKTLGRILLKGDNITLMMNTGK 88 >ACU15277.1 unknown [Glycine max] Length = 88 Score = 172 bits (435), Expect = 1e-51 Identities = 87/88 (98%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQ KARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQGKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMNTGK 88 >XP_002522808.1 PREDICTED: small nuclear ribonucleoprotein E [Ricinus communis] EEF39659.1 Small nuclear ribonucleoprotein E, putative [Ricinus communis] Length = 88 Score = 171 bits (434), Expect = 2e-51 Identities = 86/88 (97%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQ WLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQFWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMNTGK 88 >XP_007154805.1 hypothetical protein PHAVU_003G149400g [Phaseolus vulgaris] ESW26799.1 hypothetical protein PHAVU_003G149400g [Phaseolus vulgaris] Length = 88 Score = 171 bits (434), Expect = 2e-51 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMM+TGK Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMSTGK 88 >XP_004139778.1 PREDICTED: small nuclear ribonucleoprotein E [Cucumis sativus] XP_008447758.1 PREDICTED: small nuclear ribonucleoprotein E-like [Cucumis melo] KGN44143.1 hypothetical protein Csa_7G206940 [Cucumis sativus] Length = 88 Score = 171 bits (434), Expect = 2e-51 Identities = 86/88 (97%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMMN+GK Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMNSGK 88 >XP_014497376.1 PREDICTED: small nuclear ribonucleoprotein E-like [Vigna radiata var. radiata] Length = 88 Score = 171 bits (433), Expect = 2e-51 Identities = 86/88 (97%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 N+KKKSRKTLGRILLKGDNITLMM+TGK Sbjct: 61 NIKKKSRKTLGRILLKGDNITLMMSTGK 88 >XP_004490635.1 PREDICTED: small nuclear ribonucleoprotein E-like [Cicer arietinum] Length = 88 Score = 171 bits (433), Expect = 2e-51 Identities = 87/88 (98%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRKTLGRILLKGDNITLMMNT K Sbjct: 61 NVKKKSRKTLGRILLKGDNITLMMNTAK 88 >XP_003549500.1 PREDICTED: small nuclear ribonucleoprotein E [Glycine max] ACU14421.1 unknown [Glycine max] KRH02922.1 hypothetical protein GLYMA_17G067100 [Glycine max] Length = 88 Score = 171 bits (433), Expect = 2e-51 Identities = 86/88 (97%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 ++KKKSRKTLGRILLKGDNITLMMNTGK Sbjct: 61 SIKKKSRKTLGRILLKGDNITLMMNTGK 88 >XP_009606254.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tomentosiformis] XP_009592410.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tomentosiformis] XP_009779979.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana sylvestris] XP_009786529.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana sylvestris] XP_016455853.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] XP_016478942.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] XP_016486023.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] XP_016490718.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] XP_019247790.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana attenuata] XP_019255952.1 PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana attenuata] Length = 88 Score = 171 bits (432), Expect = 3e-51 Identities = 86/88 (97%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKQLGRILLKGDNITLMMNTGK 88 >ACJ83970.1 unknown [Medicago truncatula] AFK48337.1 unknown [Medicago truncatula] Length = 88 Score = 171 bits (432), Expect = 3e-51 Identities = 86/88 (97%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNL LDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLALDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKS+KTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSKKTLGRILLKGDNITLMMNTGK 88 >XP_018820851.1 PREDICTED: small nuclear ribonucleoprotein E-like [Juglans regia] XP_018831159.1 PREDICTED: small nuclear ribonucleoprotein E-like [Juglans regia] Length = 88 Score = 170 bits (431), Expect = 5e-51 Identities = 85/88 (96%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQ+DLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQRDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRK+LGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKSLGRILLKGDNITLMMNTGK 88 >XP_015948775.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis duranensis] XP_015948777.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis duranensis] XP_015948778.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis duranensis] XP_016200805.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis ipaensis] XP_016183048.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis ipaensis] XP_016183049.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis ipaensis] XP_016183050.1 PREDICTED: small nuclear ribonucleoprotein E-like [Arachis ipaensis] Length = 88 Score = 170 bits (431), Expect = 5e-51 Identities = 86/88 (97%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKK +RKTLGRILLKGDNITLMMNTGK Sbjct: 61 NVKKNTRKTLGRILLKGDNITLMMNTGK 88 >XP_002531748.2 PREDICTED: small nuclear ribonucleoprotein E [Ricinus communis] Length = 88 Score = 170 bits (431), Expect = 5e-51 Identities = 85/88 (96%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKK+RKTLGRILLKGDNITLMMN+GK Sbjct: 61 NVKKKTRKTLGRILLKGDNITLMMNSGK 88 >XP_017409631.1 PREDICTED: small nuclear ribonucleoprotein E-like [Vigna angularis] XP_017416347.1 PREDICTED: small nuclear ribonucleoprotein E-like [Vigna angularis] KOM37791.1 hypothetical protein LR48_Vigan03g117300 [Vigna angularis] BAT76688.1 hypothetical protein VIGAN_01473400 [Vigna angularis var. angularis] BAT84267.1 hypothetical protein VIGAN_04158600 [Vigna angularis var. angularis] Length = 88 Score = 170 bits (430), Expect = 6e-51 Identities = 85/88 (96%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 N+KKKS+KTLGRILLKGDNITLMM+TGK Sbjct: 61 NIKKKSKKTLGRILLKGDNITLMMSTGK 88 >XP_012477072.1 PREDICTED: small nuclear ribonucleoprotein E-like [Gossypium raimondii] XP_016714938.1 PREDICTED: small nuclear ribonucleoprotein E-like [Gossypium hirsutum] XP_016692123.1 PREDICTED: small nuclear ribonucleoprotein E-like [Gossypium hirsutum] XP_017624010.1 PREDICTED: small nuclear ribonucleoprotein E-like [Gossypium arboreum] KHG25852.1 Small nuclear ribonucleoprotein E [Gossypium arboreum] KJB27018.1 hypothetical protein B456_004G272400 [Gossypium raimondii] KJB27019.1 hypothetical protein B456_004G272400 [Gossypium raimondii] Length = 88 Score = 170 bits (430), Expect = 6e-51 Identities = 85/88 (96%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRK+LGRILLKGDNITLMMN+GK Sbjct: 61 NVKKKSRKSLGRILLKGDNITLMMNSGK 88 >XP_007137755.1 hypothetical protein PHAVU_009G153200g [Phaseolus vulgaris] ESW09749.1 hypothetical protein PHAVU_009G153200g [Phaseolus vulgaris] Length = 88 Score = 170 bits (430), Expect = 6e-51 Identities = 85/88 (96%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDL+IEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLKIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 N+KKKSRKTLGRILLKGDNITLMM+TGK Sbjct: 61 NIKKKSRKTLGRILLKGDNITLMMSTGK 88 >XP_016578180.1 PREDICTED: small nuclear ribonucleoprotein E-like [Capsicum annuum] Length = 88 Score = 169 bits (429), Expect = 9e-51 Identities = 85/88 (96%), Positives = 87/88 (98%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDA+EV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDADEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 NVKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 61 NVKKKSRKQLGRILLKGDNITLMMNTGK 88 >XP_017981974.1 PREDICTED: small nuclear ribonucleoprotein E [Theobroma cacao] EOY31715.1 Small nuclear ribonucleoprotein family protein [Theobroma cacao] Length = 88 Score = 169 bits (429), Expect = 9e-51 Identities = 84/88 (95%), Positives = 88/88 (100%) Frame = +3 Query: 135 MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 314 MASTKVQR+MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60 Query: 315 NVKKKSRKTLGRILLKGDNITLMMNTGK 398 N+KKKSRK+LGRILLKGDNITLMMN+GK Sbjct: 61 NIKKKSRKSLGRILLKGDNITLMMNSGK 88