BLASTX nr result
ID: Glycyrrhiza33_contig00003425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00003425 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KTD17649.1 Cell wall-associated hydrolase [Legionella jordanis] 228 2e-75 KTC66799.1 Cell wall-associated hydrolase [Legionella birmingham... 227 3e-75 KTD43806.1 Cell wall-associated hydrolase [Legionella oakridgensis] 226 8e-75 KTC66576.1 Cell wall-associated hydrolase [Legionella adelaidens... 226 8e-75 KTC80513.1 Cell wall-associated hydrolase [Legionella cherrii] K... 226 1e-74 XP_003088200.1 hypothetical protein CRE_03576 [Caenorhabditis re... 226 1e-74 KTC95109.1 Cell wall-associated hydrolase [Legionella feeleii] 225 2e-74 KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholder... 229 3e-74 BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BA... 229 3e-74 BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BA... 229 3e-74 BAG46932.1 cell wall-associated hydrolase [Burkholderia multivor... 229 3e-74 ACJ56573.1 hypothetical protein ABBFA_003495 [Acinetobacter baum... 224 7e-74 EEW06587.1 conserved hypothetical protein [Vibrio mimicus VM603] 223 3e-73 KNH50143.1 cell wall-associated hydrolase, partial [Vibrio chole... 222 3e-73 CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] 224 4e-73 EXC83814.1 putative cell wall-associated hydrolase, partial [Aci... 221 5e-73 EGR05231.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] 222 5e-73 EXH74502.1 putative cell wall-associated hydrolase [Acinetobacte... 221 5e-73 KNH56572.1 cell wall-associated hydrolase, partial [Vibrio chole... 222 5e-73 ELT25191.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] 222 5e-73 >KTD17649.1 Cell wall-associated hydrolase [Legionella jordanis] Length = 122 Score = 228 bits (580), Expect = 2e-75 Identities = 111/118 (94%), Positives = 111/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SYPAM LA QPVHQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSELSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KTC66799.1 Cell wall-associated hydrolase [Legionella birminghamensis] KTD49697.1 Cell wall-associated hydrolase [Legionella quinlivanii] Length = 122 Score = 227 bits (579), Expect = 3e-75 Identities = 111/118 (94%), Positives = 111/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SYPAM LA QPVHQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSELSYPAMRLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KTD43806.1 Cell wall-associated hydrolase [Legionella oakridgensis] Length = 122 Score = 226 bits (576), Expect = 8e-75 Identities = 110/118 (93%), Positives = 111/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI S+ SYPAM LA QPVHQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSKLSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KTC66576.1 Cell wall-associated hydrolase [Legionella adelaidensis] KTD08136.1 Cell wall-associated hydrolase [Legionella jamestowniensis] KTD09916.1 Cell wall-associated hydrolase [Legionella hackeliae] KTD22073.1 Cell wall-associated hydrolase [Legionella lansingensis] KTD27116.1 Cell wall-associated hydrolase [Legionella maceachernii] KTD27396.1 Cell wall-associated hydrolase [Tatlockia micdadei] KTD65293.1 Cell wall-associated hydrolase [Legionella spiritensis] KTD78129.1 Cell wall-associated hydrolase [Legionella steigerwaltii] Length = 122 Score = 226 bits (576), Expect = 8e-75 Identities = 110/118 (93%), Positives = 111/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SYPAM LA QPVHQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSELSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFH+EPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHSEPPD 121 >KTC80513.1 Cell wall-associated hydrolase [Legionella cherrii] KTC87315.1 Cell wall-associated hydrolase [Legionella drozanskii LLAP-1] KTD33299.1 Cell wall-associated hydrolase [Legionella nautarum] Length = 122 Score = 226 bits (575), Expect = 1e-74 Identities = 110/118 (93%), Positives = 111/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SYPAM LA QPVHQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSELSYPAMRLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFH+EPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHSEPPD 121 >XP_003088200.1 hypothetical protein CRE_03576 [Caenorhabditis remanei] EFO92753.1 hypothetical protein CRE_03576 [Caenorhabditis remanei] Length = 122 Score = 226 bits (575), Expect = 1e-74 Identities = 109/118 (92%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SEHSYPAM LA QPVHQRFVHSGPLVLGA PLK PTPT DRDRTVSRRSKPSSRT+ Sbjct: 4 AVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPTPTVDRDRTVSRRSKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KTC95109.1 Cell wall-associated hydrolase [Legionella feeleii] Length = 122 Score = 225 bits (573), Expect = 2e-74 Identities = 110/118 (93%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SYPAM LA QP HQRFVHSGPLVLGAAPL PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIPSELSYPAMRLASQPEHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 229 bits (583), Expect = 3e-74 Identities = 110/118 (93%), Positives = 112/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRD+TVSRR KPSSRT+ Sbjct: 4 AVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BAO87487.1 putative membrane protein [Burkholderia sp. RPE67] BAO87598.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 229 bits (583), Expect = 3e-74 Identities = 110/118 (93%), Positives = 112/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRD+TVSRR KPSSRT+ Sbjct: 4 AVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BAO88159.1 putative membrane protein [Burkholderia sp. RPE67] BAO90886.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 229 bits (583), Expect = 3e-74 Identities = 110/118 (93%), Positives = 112/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRD+TVSRR KPSSRT+ Sbjct: 4 AVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >BAG46932.1 cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 229 bits (583), Expect = 3e-74 Identities = 110/118 (93%), Positives = 112/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRD+TVSRR KPSSRT+ Sbjct: 4 AVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >ACJ56573.1 hypothetical protein ABBFA_003495 [Acinetobacter baumannii AB307-0294] ACJ57003.1 hypothetical protein ABBFA_000018 [Acinetobacter baumannii AB307-0294] ACJ58012.1 hypothetical protein ABBFA_003346 [Acinetobacter baumannii AB307-0294] ACJ58035.1 hypothetical protein ABBFA_000530 [Acinetobacter baumannii AB307-0294] ACJ58296.1 hypothetical protein ABBFA_000501 [Acinetobacter baumannii AB307-0294] ACJ59205.1 hypothetical protein ABBFA_002935 [Acinetobacter baumannii AB307-0294] EEY88218.1 hypothetical protein HMPREF0018_00965 [Acinetobacter radioresistens SH164] EGJ68585.1 hypothetical protein HMPREF0022_01653 [Acinetobacter baumannii 6014059] EJO37198.1 hypothetical protein ACINWCA157_1046 [Acinetobacter radioresistens WC-A-157] EKA64024.1 hypothetical protein ACINIS143_3496 [Acinetobacter baumannii IS-143] EKA65488.1 hypothetical protein ACINIS116_3360 [Acinetobacter baumannii IS-116] EKA67924.1 hypothetical protein ACINIS116_3390 [Acinetobacter baumannii IS-116] EKA68035.1 hypothetical protein ACINIS143_3968 [Acinetobacter baumannii IS-143] EKA69485.1 hypothetical protein ACINIS143_0246 [Acinetobacter baumannii IS-143] EKA69768.1 hypothetical protein ACINIS116_3856 [Acinetobacter baumannii IS-116] EKA70718.1 hypothetical protein ACINIS143_0685 [Acinetobacter baumannii IS-143] EKA70762.1 hypothetical protein ACINIS116_0212 [Acinetobacter baumannii IS-116] EKA74612.1 hypothetical protein ACINIS143_3466 [Acinetobacter baumannii IS-143] EKA75180.1 hypothetical protein ACINIS58_3418 [Acinetobacter baumannii IS-58] EKA76750.1 hypothetical protein ACINIS58_0208 [Acinetobacter baumannii IS-58] EKA77851.1 hypothetical protein ACINIS58_3911 [Acinetobacter baumannii IS-58] EKA78350.1 hypothetical protein ACINIS58_0056 [Acinetobacter baumannii IS-58] EKA78418.1 hypothetical protein ACINIS58_3449 [Acinetobacter baumannii IS-58] EKK06401.1 hypothetical protein ACINIS235_0201 [Acinetobacter baumannii IS-235] EKK14106.1 hypothetical protein ACINIS235_0052 [Acinetobacter baumannii IS-235] EKK15021.1 hypothetical protein ACINIS235_3424 [Acinetobacter baumannii IS-235] EKK16055.1 hypothetical protein ACINIS235_3883 [Acinetobacter baumannii IS-235] EKK16806.1 hypothetical protein ACINIS235_3392 [Acinetobacter baumannii IS-235] EKP31189.1 hypothetical protein ACIN5099_3257 [Acinetobacter baumannii OIFC099] EKP33385.1 hypothetical protein ACIN5099_0055 [Acinetobacter baumannii OIFC099] EKP36085.1 hypothetical protein ACIN5099_0687 [Acinetobacter baumannii OIFC099] EKP36959.1 hypothetical protein ACIN5099_0209 [Acinetobacter baumannii OIFC099] EKP38096.1 hypothetical protein ACIN5099_3292 [Acinetobacter baumannii OIFC099] EKP65413.1 hypothetical protein ACIN5035_3304 [Acinetobacter baumannii OIFC035] EKP65885.1 hypothetical protein ACIN5035_0683 [Acinetobacter baumannii OIFC035] EKP66997.1 hypothetical protein ACIN5035_0052 [Acinetobacter baumannii OIFC035] EKP67772.1 hypothetical protein ACIN5035_3340 [Acinetobacter baumannii OIFC035] EKP68757.1 hypothetical protein ACIN5035_3822 [Acinetobacter baumannii OIFC035] EKP69488.1 hypothetical protein ACIN5035_0207 [Acinetobacter baumannii OIFC035] EKU62542.1 hypothetical protein ACINNAV113_3619 [Acinetobacter baumannii Naval-113] EKU63494.1 hypothetical protein ACINNAV113_4085 [Acinetobacter baumannii Naval-113] EKU63987.1 hypothetical protein ACINNAV113_0055 [Acinetobacter baumannii Naval-113] EKU64909.1 hypothetical protein ACINNAV113_0715 [Acinetobacter baumannii Naval-113] EKU66641.1 hypothetical protein ACINWC136_0224 [Acinetobacter sp. WC-136] EKU67036.1 hypothetical protein ACINWC136_0056 [Acinetobacter sp. WC-136] EKU67661.1 hypothetical protein ACINWC136_4089 [Acinetobacter sp. WC-136] EKU68279.1 hypothetical protein ACINWC136_3562 [Acinetobacter sp. WC-136] ELX04581.1 hypothetical protein ACINNAV57_3370 [Acinetobacter baumannii Naval-57] ELX06634.1 hypothetical protein ACINNAV57_3827 [Acinetobacter baumannii Naval-57] ELX06832.1 hypothetical protein ACINNAV57_3339 [Acinetobacter baumannii Naval-57] ELX07925.1 hypothetical protein ACINNAV57_0209 [Acinetobacter baumannii Naval-57] ENV81378.1 hypothetical protein F941_03209 [Acinetobacter bouvetii DSM 14964 = CIP 107468] ENV81907.1 hypothetical protein F941_02726 [Acinetobacter bouvetii DSM 14964 = CIP 107468] ENV85889.1 hypothetical protein F940_01649 [Acinetobacter radioresistens NIPH 2130] AGQ15642.1 hypothetical protein BJAB07104_03274 [Acinetobacter baumannii BJAB07104] AGQ15670.1 hypothetical protein BJAB07104_03303 [Acinetobacter baumannii BJAB07104] AGQ04647.1 hypothetical protein BJAB0715_00001 [Acinetobacter baumannii BJAB0715] AGQ04700.1 hypothetical protein BJAB0715_00054 [Acinetobacter baumannii BJAB0715] AGQ04866.1 hypothetical protein BJAB0715_00220 [Acinetobacter baumannii BJAB0715] AGQ05315.1 hypothetical protein BJAB0715_00669 [Acinetobacter baumannii BJAB0715] AGQ07982.1 hypothetical protein BJAB0715_03336 [Acinetobacter baumannii BJAB0715] AGQ08013.1 hypothetical protein BJAB0715_03367 [Acinetobacter baumannii BJAB0715] ETR91237.1 putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] ETR92139.1 putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] ETR92181.1 putative cell wall-associated hydrolase [Acinetobacter baumannii CI77] EXA77652.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1202252] EXA82082.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1202252] EXB07597.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] EXB07603.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] EXB07877.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB08523.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB09023.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] EXB09591.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB10646.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB11015.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] EXB11818.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB12303.1 putative cell wall-associated hydrolase [Acinetobacter sp. 1396970] EXB13575.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1397084] EXB28822.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] EXB33839.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] EXB34479.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1419130] EXB67409.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB67678.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB68289.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB68596.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB69429.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB70524.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB72741.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB73307.1 putative cell wall-associated hydrolase [Acinetobacter sp. 230853] EXB75801.1 putative cell wall-associated hydrolase [Acinetobacter sp. 272263] EXB84618.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 299505] EXB85488.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 299505] EXB86305.1 putative cell wall-associated hydrolase [Acinetobacter sp. 272263] EXB88905.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXB89486.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXB95163.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXB95323.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXB97063.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXB97912.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 400834] EXC32406.1 putative cell wall-associated hydrolase [Acinetobacter sp. 869535] EXC46668.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] EXC47448.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] EXC47699.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] EXC50262.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 99063] EXC52490.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 99063] EXC53833.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1032241] EXC57037.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] EXC64518.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] EXC70231.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1036938] EXC78762.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1046051] EXC81943.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1043903] EXC87053.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1051176] EXD50025.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 564012] EXE06492.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] EXE08192.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] EXE10248.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] EXE11942.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1277411] EXE35241.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1546444] EXE35386.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1546444] EXE54109.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXE54509.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXE56164.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXE56478.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXE64125.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXE65082.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552865] EXF96770.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] EXF96809.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] EXF97474.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] EXF97756.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] EXF98316.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] EXF98734.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1488685] EXF99449.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1552389] EXG21786.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] EXG24099.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] EXG26691.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] EXG28630.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 323408] EXH29661.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] EXH34079.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] EXH36769.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1207552] EXH74685.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 273929] EXH75771.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] EXH75847.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] EXH78551.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] EXH79478.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 23671] EXH81063.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 273929] EXH86253.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 2887] EXH87056.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 2887] EXI16924.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 737393] EXQ84249.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] EXQ86861.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] EXQ87344.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] EXQ91373.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 11126] EXR76949.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 339786] EXR93517.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] EXR93636.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] EXR97240.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 145660] EXS07468.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] EXS10216.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] EXS12783.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 628418] EXS20972.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 730795] EXS25922.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 730795] EXS40417.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] EXS40806.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] EXS43527.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] EXS43864.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 213697] EXS46597.1 putative cell wall-associated hydrolase [Acinetobacter sp. 88816] EXS60956.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 70136] EXS62541.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 70136] EXS72437.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] EXS72855.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] EXS73955.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_7] EXS78302.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_6] EXS79412.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] EXS81552.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] EXS81642.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] EXS82795.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] EXS83308.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_5] EXS84329.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] EXS86042.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] EXS86241.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_4] EXS88871.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] EXS89104.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] EXS90133.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] EXS90287.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_3] EXS90951.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXS92972.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] EXS92978.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXS93246.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXS93358.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_8] EXS93741.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXS94267.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXS95629.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 45002_10] EXT96999.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] EXT98753.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] EXT99437.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] EXU00119.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25253_7] EXW15876.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25766_4] EXW19255.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25766_4] EXW37188.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] EXW37584.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] EXW38153.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] EXW38282.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] EXW40302.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44327_6] EXX35894.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25681_3] EXX38543.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25681_3] EYD40136.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] EYD41648.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] EYD46279.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 25493_5] EYS66810.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 16553_4] EYS67310.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 16553_4] EYT16489.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 655378] EYT32573.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1121032] EYU51770.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1428368] EYU52059.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1428368] KCV92197.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44839_8] KCV92211.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44839_8] KCV94327.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44839_8] KCV99148.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 44839_8] KCW27970.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 6935] KCW28145.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 6935] KCW28182.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 6935] KCW30518.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 6935] KCX14046.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1539026] KCX18389.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1539026] KCX18772.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1539026] KCX20091.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1539026] KCX22183.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 916567] KCX27428.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 916567] KCX28041.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 916567] KCX31737.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 96512] KCX31953.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 96512] KCX33147.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 96512] KCX64991.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1146103] KCX65475.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1146103] KCX65533.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1146103] KCX66688.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1146103] KCX68140.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1146103] KCX75551.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 855125] KCX77561.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 754286] KCX78566.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 754286] KCX80077.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 754286] KCX94694.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCX95652.1 putative cell wall-associated hydrolase [Acinetobacter sp. 72431] KCX96569.1 putative cell wall-associated hydrolase [Acinetobacter sp. 72431] KCX96833.1 putative cell wall-associated hydrolase [Acinetobacter sp. 72431] KCX99715.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCX99991.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCY02183.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCY02287.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCY02663.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1499986] KCY05941.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 21072] KCY06152.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1284800] KCY06852.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 21072] KCY09183.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1284800] KCY10187.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 21072] KCY14286.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1284800] KCY16509.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 21072] KCY16699.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1284800] KCY17002.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1284800] KCY17509.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 21072] KCY38150.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1276470-132] KCY38900.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1276470-132] KCY39192.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1276470-132] KCY43840.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1571545] KCY50566.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1571545] KCY56716.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 1288284] KCY60353.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 24860_5] KCY61215.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 24860_5] KCY63066.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 24860_9] KCY67172.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 24860_9] KCY67815.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 24860_9] KCY72456.1 putative cell wall-associated hydrolase [Acinetobacter sp. 796380-1375] KCY78214.1 putative cell wall-associated hydrolase [Acinetobacter sp. 796380-1375] KCZ17963.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 42057_3] KCZ18228.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 42057_3] Length = 122 Score = 224 bits (570), Expect = 7e-74 Identities = 108/118 (91%), Positives = 109/118 (92%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SEHSYPAM LA QPVHQRFVHSGPLVLGA PLK P PT DRDRTVSRRSKPSSRT+ Sbjct: 4 AVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVSRRSKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >EEW06587.1 conserved hypothetical protein [Vibrio mimicus VM603] Length = 144 Score = 223 bits (568), Expect = 3e-73 Identities = 109/118 (92%), Positives = 109/118 (92%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SE SY AM LA QP HQRFVHSGPLVLGAAP PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 AVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KNH50143.1 cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 124 Score = 222 bits (566), Expect = 3e-73 Identities = 108/118 (91%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 A+I+SE SY AM LA QP HQRFVHSGPLVLGAAP PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 ALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 177 Score = 224 bits (570), Expect = 4e-73 Identities = 109/118 (92%), Positives = 112/118 (94%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 A+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP+K PTPTADRD+TVSRR KPSSRTT Sbjct: 4 ALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >EXC83814.1 putative cell wall-associated hydrolase, partial [Acinetobacter baumannii 1043903] Length = 120 Score = 221 bits (564), Expect = 5e-73 Identities = 107/117 (91%), Positives = 108/117 (92%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SEHSYPAM LA QPVHQRFVHSGPLVLGA PLK P PT DRDRTVSRRSKPSSRT+ Sbjct: 4 AVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVSRRSKPSSRTS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 353 LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 64 LNGEQPYPWDLLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 >EGR05231.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] Length = 142 Score = 222 bits (566), Expect = 5e-73 Identities = 108/118 (91%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 A+I+SE SY AM LA QP HQRFVHSGPLVLGAAP PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 ALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >EXH74502.1 putative cell wall-associated hydrolase [Acinetobacter baumannii 273929] Length = 122 Score = 221 bits (564), Expect = 5e-73 Identities = 107/118 (90%), Positives = 108/118 (91%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 AVI SEHSYPAM LA QPVHQRFVHSGPLVLGA PLK P PT DRDRTVSRRSKPSSR + Sbjct: 4 AVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVSRRSKPSSRPS 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDLLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >KNH56572.1 cell wall-associated hydrolase, partial [Vibrio cholerae 1587] Length = 144 Score = 222 bits (566), Expect = 5e-73 Identities = 108/118 (91%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 A+I+SE SY AM LA QP HQRFVHSGPLVLGAAP PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 ALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121 >ELT25191.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] Length = 144 Score = 222 bits (566), Expect = 5e-73 Identities = 108/118 (91%), Positives = 110/118 (93%) Frame = +3 Query: 3 AVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPLKSPTPTADRDRTVSRRSKPSSRTT 182 A+I+SE SY AM LA QP HQRFVHSGPLVLGAAP PTPTADRDRTVSRRSKPSSRTT Sbjct: 4 ALINSELSYRAMRLAAQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRTT 63 Query: 183 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 356 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD Sbjct: 64 LNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPD 121