BLASTX nr result
ID: Glycyrrhiza33_contig00002903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00002903 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI23544.3 unnamed protein product, partial [Vitis vinifera] 118 6e-32 AEZ00889.1 putative chloroplast starch synthase III, partial [El... 121 1e-31 XP_014518398.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 3e-31 XP_017436039.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 3e-31 KRH11435.1 hypothetical protein GLYMA_15G108000 [Glycine max] 127 4e-31 XP_003541618.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 4e-31 KHN33026.1 Soluble starch synthase 3, chloroplastic/amyloplastic... 127 4e-31 XP_003546152.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 4e-31 XP_006597587.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 4e-31 XP_006597585.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 127 4e-31 XP_013462827.1 soluble starch synthase III-1 [Medicago truncatul... 125 1e-30 XP_013462828.1 soluble starch synthase III-1 [Medicago truncatul... 125 1e-30 XP_006348120.1 PREDICTED: soluble starch synthase 3, chloroplast... 125 1e-30 CAA64173.1 soluble-starch-synthase [Solanum tuberosum] 125 1e-30 Q43846.1 RecName: Full=Soluble starch synthase 3, chloroplastic/... 125 1e-30 NP_001274802.1 soluble starch synthase 3, chloroplastic/amylopla... 125 1e-30 XP_016560124.1 PREDICTED: soluble starch synthase 3, chloroplast... 124 3e-30 EPS63413.1 hypothetical protein M569_11372, partial [Genlisea au... 115 7e-30 XP_016487730.1 PREDICTED: soluble starch synthase 3, chloroplast... 123 8e-30 XP_009594930.1 PREDICTED: soluble starch synthase 3, chloroplast... 123 8e-30 >CBI23544.3 unnamed protein product, partial [Vitis vinifera] Length = 83 Score = 118 bits (295), Expect = 6e-32 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARK 292 FDGAD GVDYALNRAISAWY+GRDWFN+LCK+VMEQDWSWNRPALDY+ELYHAARK Sbjct: 27 FDGADSVGVDYALNRAISAWYDGRDWFNSLCKQVMEQDWSWNRPALDYMELYHAARK 83 >AEZ00889.1 putative chloroplast starch synthase III, partial [Elaeis guineensis] Length = 221 Score = 121 bits (304), Expect = 1e-31 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARK 292 FDGAD GGVDYALNRAISAWY+GR+WFN+LCKRVMEQDWSWNRPALDY+ELYHAARK Sbjct: 165 FDGADPGGVDYALNRAISAWYDGREWFNSLCKRVMEQDWSWNRPALDYMELYHAARK 221 >XP_014518398.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Vigna radiata var. radiata] Length = 1162 Score = 127 bits (320), Expect = 3e-31 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGADVGGVDYALNRAI+AWY+GRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK+E Sbjct: 1104 FDGADVGGVDYALNRAITAWYDGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKIE 1162 >XP_017436039.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X1 [Vigna angularis] XP_017436040.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X2 [Vigna angularis] KOM53420.1 hypothetical protein LR48_Vigan09g207900 [Vigna angularis] BAT87461.1 hypothetical protein VIGAN_05082900 [Vigna angularis var. angularis] Length = 1165 Score = 127 bits (320), Expect = 3e-31 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGADVGGVDYALNRAI+AWY+GRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK+E Sbjct: 1107 FDGADVGGVDYALNRAITAWYDGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKIE 1165 >KRH11435.1 hypothetical protein GLYMA_15G108000 [Glycine max] Length = 898 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 840 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 898 >XP_003541618.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] XP_006594421.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] XP_014621196.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] KHN37605.1 Soluble starch synthase 3, chloroplastic/amyloplastic [Glycine soja] KRH20852.1 hypothetical protein GLYMA_13G204700 [Glycine max] KRH20853.1 hypothetical protein GLYMA_13G204700 [Glycine max] Length = 1149 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 1091 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 1149 >KHN33026.1 Soluble starch synthase 3, chloroplastic/amyloplastic [Glycine soja] Length = 1162 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 1104 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 1162 >XP_003546152.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X3 [Glycine max] KRH11434.1 hypothetical protein GLYMA_15G108000 [Glycine max] Length = 1166 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 1108 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 1166 >XP_006597587.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] Length = 1168 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 1110 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 1168 >XP_006597585.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X1 [Glycine max] Length = 1176 Score = 127 bits (319), Expect = 4e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWYEGRDWFN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 1118 FDGADTGGVDYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 1176 >XP_013462827.1 soluble starch synthase III-1 [Medicago truncatula] KEH36863.1 soluble starch synthase III-1 [Medicago truncatula] Length = 925 Score = 125 bits (315), Expect = 1e-30 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWY+GR+WFNTLCK VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 867 FDGADAGGVDYALNRAISAWYDGREWFNTLCKTVMEQDWSWNRPALDYLELYHAARKLE 925 >XP_013462828.1 soluble starch synthase III-1 [Medicago truncatula] KEH36862.1 soluble starch synthase III-1 [Medicago truncatula] Length = 1109 Score = 125 bits (315), Expect = 1e-30 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRAISAWY+GR+WFNTLCK VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1051 FDGADAGGVDYALNRAISAWYDGREWFNTLCKTVMEQDWSWNRPALDYLELYHAARKLE 1109 >XP_006348120.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Solanum tuberosum] Length = 1180 Score = 125 bits (315), Expect = 1e-30 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1122 FDGADAGGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1180 >CAA64173.1 soluble-starch-synthase [Solanum tuberosum] Length = 1230 Score = 125 bits (315), Expect = 1e-30 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1172 FDGADAGGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >Q43846.1 RecName: Full=Soluble starch synthase 3, chloroplastic/amyloplastic; AltName: Full=Soluble starch synthase III; Short=SS III; Flags: Precursor CAA65065.1 glycogen (starch) synthase [Solanum tuberosum] Length = 1230 Score = 125 bits (315), Expect = 1e-30 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1172 FDGADAGGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >NP_001274802.1 soluble starch synthase 3, chloroplastic/amyloplastic [Solanum tuberosum] ACT83376.1 soluble starch synthase [Solanum tuberosum] Length = 1230 Score = 125 bits (315), Expect = 1e-30 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1172 FDGADAGGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >XP_016560124.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic [Capsicum annuum] Length = 1249 Score = 124 bits (312), Expect = 3e-30 Identities = 53/59 (89%), Positives = 58/59 (98%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GGVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKL+ Sbjct: 1191 FDGADAGGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLD 1249 >EPS63413.1 hypothetical protein M569_11372, partial [Genlisea aurea] Length = 166 Score = 115 bits (288), Expect = 7e-30 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARK 292 F+GAD GVDYALNRAIS WYEGRDWF++LC+RVMEQDWSWNRPALDYLE+YHAARK Sbjct: 109 FEGADPAGVDYALNRAISGWYEGRDWFDSLCRRVMEQDWSWNRPALDYLEVYHAARK 165 >XP_016487730.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana tabacum] Length = 1210 Score = 123 bits (309), Expect = 8e-30 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1152 FDGADAAGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1210 >XP_009594930.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana tomentosiformis] Length = 1210 Score = 123 bits (309), Expect = 8e-30 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -1 Query: 462 FDGADVGGVDYALNRAISAWYEGRDWFNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 286 FDGAD GVDYALNRA+SAWY+GRDWFN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1152 FDGADAAGVDYALNRALSAWYDGRDWFNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1210