BLASTX nr result
ID: Glycyrrhiza33_contig00001861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00001861 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003590903.1 hypothetical protein MTR_1g079480 [Medicago trunc... 56 5e-08 KFV71730.1 hypothetical protein N307_11227, partial [Picoides pu... 52 3e-06 KFW11813.1 hypothetical protein N327_00705, partial [Fulmarus gl... 51 6e-06 >XP_003590903.1 hypothetical protein MTR_1g079480 [Medicago truncatula] AES61154.1 hypothetical protein MTR_1g079480 [Medicago truncatula] Length = 64 Score = 56.2 bits (134), Expect = 5e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 141 MFGLTK*DGM*WNGMG*HGVSLFGFLKNGWNGMEPNGIYSISFHHL 4 MFGL +GM W GM V LF FLK GWNGME +GI+SI +HHL Sbjct: 1 MFGLMDCNGMEWYGMVRGYVPLFRFLKIGWNGMEHDGIHSIPYHHL 46 >KFV71730.1 hypothetical protein N307_11227, partial [Picoides pubescens] Length = 56 Score = 51.6 bits (122), Expect = 3e-06 Identities = 21/35 (60%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -2 Query: 127 EIGWNVMEWNGMTWSFIVWIS*KW--MEWNGT*WN 29 EIGWN MEWNGM W+ + W +W MEWNG WN Sbjct: 17 EIGWNGMEWNGMEWNGMEWNGMEWNGMEWNGMEWN 51 >KFW11813.1 hypothetical protein N327_00705, partial [Fulmarus glacialis] Length = 59 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -2 Query: 145 GYVWIDEIGWNVMEWNGMTWSFIVWIS*KW--MEWNGT*WN 29 G W D +GWN MEWNGM W+ + W +W MEWNG WN Sbjct: 15 GIEW-DGMGWNRMEWNGMEWNGMEWNGMEWNGMEWNGMEWN 54