BLASTX nr result
ID: Glycyrrhiza33_contig00001798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00001798 (1705 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019462294.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-09 KOM37912.1 hypothetical protein LR48_Vigan03g129400 [Vigna angul... 65 7e-09 XP_004514268.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 2e-08 XP_014498267.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-07 XP_017419488.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-07 XP_007140612.1 hypothetical protein PHAVU_008G126700g [Phaseolus... 64 3e-07 XP_003532287.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-06 GAU18245.1 hypothetical protein TSUD_175870 [Trifolium subterran... 59 2e-06 XP_013448704.1 PPR containing plant-like protein [Medicago trunc... 61 4e-06 KHN11005.1 Pentatricopeptide repeat-containing protein, chloropl... 60 4e-06 XP_016185822.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 9e-06 XP_015956612.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 9e-06 >XP_019462294.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Lupinus angustifolius] OIW01278.1 hypothetical protein TanjilG_10439 [Lupinus angustifolius] Length = 511 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K IIDKR KKGSINS KL PRTVLEALHER+ AL WESAL+V Sbjct: 97 KAIIDKRNRKKGSINSKKLLPRTVLEALHERITALRWESALKV 139 >KOM37912.1 hypothetical protein LR48_Vigan03g129400 [Vigna angularis] Length = 165 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 1209 KGIIDKR-RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDK R KKG INS KL PRTVLEALHERVAAL WESAL+V Sbjct: 99 KAVIDKSGRKKKGPINSKKLLPRTVLEALHERVAALRWESALKV 142 >XP_004514268.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Cicer arietinum] Length = 520 Score = 68.2 bits (165), Expect = 2e-08 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K IIDKRR KKG INS KL PRTVLEALHER+AAL WESAL+V Sbjct: 107 KAIIDKRR-KKGPINSKKLLPRTVLEALHERIAALRWESALKV 148 >XP_014498267.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Vigna radiata var. radiata] Length = 512 Score = 65.9 bits (159), Expect = 1e-07 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 1209 KGIIDKR-RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDK R KKG INS KL PRTVLEALHERVAAL WESAL+V Sbjct: 97 KAVIDKNGRKKKGPINSKKLLPRTVLEALHERVAALRWESALKV 140 >XP_017419488.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Vigna angularis] Length = 514 Score = 65.5 bits (158), Expect = 1e-07 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 1209 KGIIDKR-RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDK R KKG INS KL PRTVLEALHERVAAL WESAL+V Sbjct: 99 KAVIDKSGRKKKGPINSKKLLPRTVLEALHERVAALRWESALKV 142 >XP_007140612.1 hypothetical protein PHAVU_008G126700g [Phaseolus vulgaris] ESW12606.1 hypothetical protein PHAVU_008G126700g [Phaseolus vulgaris] Length = 513 Score = 64.3 bits (155), Expect = 3e-07 Identities = 33/44 (75%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 1209 KGIIDKR-RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDK R KKG IN+ KL PRTVLEALHERVAAL WESAL+V Sbjct: 98 KAVIDKSGRKKKGPINAKKLLPRTVLEALHERVAALRWESALKV 141 >XP_003532287.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Glycine max] KRH46714.1 hypothetical protein GLYMA_08G352500 [Glycine max] Length = 515 Score = 62.4 bits (150), Expect = 1e-06 Identities = 33/46 (71%), Positives = 35/46 (76%), Gaps = 3/46 (6%) Frame = -2 Query: 1209 KGIIDKR---RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDK R KKG INS KL PRTVLEALHERV AL WESAL+V Sbjct: 98 KAMIDKSGGGRKKKGPINSKKLLPRTVLEALHERVTALRWESALKV 143 >GAU18245.1 hypothetical protein TSUD_175870 [Trifolium subterraneum] Length = 159 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALR 1084 K IIDKRR KKG +N KL P+TVLEAL+ER+AA WESAL+ Sbjct: 109 KAIIDKRR-KKGPVNPKKLLPQTVLEALNERIAAFRWESALK 149 >XP_013448704.1 PPR containing plant-like protein [Medicago truncatula] KEH22731.1 PPR containing plant-like protein [Medicago truncatula] Length = 508 Score = 60.8 bits (146), Expect = 4e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K +IDKRR +KG +NS KL PRTVLEAL+ER++A WESAL+V Sbjct: 95 KAVIDKRR-RKGPVNSKKLLPRTVLEALNERISAFRWESALKV 136 >KHN11005.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 416 Score = 60.5 bits (145), Expect = 4e-06 Identities = 32/44 (72%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -2 Query: 1203 IIDKR---RTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 +IDK R KKG INS KL PRTVLEALHERV AL WESAL+V Sbjct: 1 MIDKSGGGRKKKGPINSKKLLPRTVLEALHERVTALRWESALKV 44 >XP_016185822.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis ipaensis] XP_016185829.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis ipaensis] Length = 520 Score = 59.7 bits (143), Expect = 9e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K IID RR +KG N KL PRTVLEALHERV AL WESAL++ Sbjct: 107 KAIIDSRR-RKGPTNPKKLLPRTVLEALHERVTALRWESALKI 148 >XP_015956612.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis duranensis] XP_015956617.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis duranensis] Length = 520 Score = 59.7 bits (143), Expect = 9e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -2 Query: 1209 KGIIDKRRTKKGSINSNKLFPRTVLEALHERVAALHWESALRV 1081 K IID RR +KG N KL PRTVLEALHERV AL WESAL++ Sbjct: 107 KAIIDSRR-RKGPTNPKKLLPRTVLEALHERVTALRWESALKI 148