BLASTX nr result
ID: Glycyrrhiza33_contig00001633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00001633 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442989.1 ubiquinone biosynthesis protein UbiB [Medicago tr... 61 2e-08 XP_004515472.1 PREDICTED: uncharacterized aarF domain-containing... 60 3e-08 XP_007134807.1 hypothetical protein PHAVU_010G077900g [Phaseolus... 60 5e-08 XP_003516441.1 PREDICTED: uncharacterized aarF domain-containing... 60 5e-08 XP_003521978.1 PREDICTED: uncharacterized aarF domain-containing... 59 2e-07 KHN38818.1 Putative aarF domain-containing protein kinase, chlor... 59 2e-07 XP_017442474.1 PREDICTED: uncharacterized aarF domain-containing... 58 3e-07 XP_014492932.1 PREDICTED: uncharacterized aarF domain-containing... 57 8e-07 KHN25542.1 Putative aarF domain-containing protein kinase, chlor... 56 1e-06 XP_003516816.1 PREDICTED: uncharacterized aarF domain-containing... 56 1e-06 XP_008233415.1 PREDICTED: uncharacterized aarF domain-containing... 56 1e-06 KYP53431.1 hypothetical protein KK1_024565 [Cajanus cajan] 55 3e-06 KCW70406.1 hypothetical protein EUGRSUZ_F03639 [Eucalyptus grandis] 55 3e-06 XP_018731700.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized a... 55 3e-06 KYP46463.1 hypothetical protein KK1_031919 [Cajanus cajan] 55 3e-06 GAU13022.1 hypothetical protein TSUD_173220 [Trifolium subterran... 55 4e-06 XP_014524035.1 PREDICTED: uncharacterized aarF domain-containing... 55 4e-06 XP_015950602.1 PREDICTED: uncharacterized aarF domain-containing... 55 4e-06 XP_016184119.1 PREDICTED: uncharacterized aarF domain-containing... 55 4e-06 XP_009372672.1 PREDICTED: uncharacterized aarF domain-containing... 54 5e-06 >XP_013442989.1 ubiquinone biosynthesis protein UbiB [Medicago truncatula] KEH17014.1 ubiquinone biosynthesis protein UbiB [Medicago truncatula] Length = 701 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EARRLGG VM GITQRL ARFLQQVLRVPATAST Sbjct: 668 EARRLGGGVMDGITQRLVARFLQQVLRVPATAST 701 >XP_004515472.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Cicer arietinum] Length = 700 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 E RRLGG V+GGITQRLAARFLQQVLRVPATAS Sbjct: 667 EVRRLGGGVVGGITQRLAARFLQQVLRVPATAS 699 >XP_007134807.1 hypothetical protein PHAVU_010G077900g [Phaseolus vulgaris] ESW06801.1 hypothetical protein PHAVU_010G077900g [Phaseolus vulgaris] Length = 718 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLGG V+GGITQRLAARFLQQ+LRVP+TAS Sbjct: 685 EARRLGGRVVGGITQRLAARFLQQILRVPSTAS 717 >XP_003516441.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Glycine max] XP_006573417.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Glycine max] KHN47909.1 Putative aarF domain-containing protein kinase, chloroplastic [Glycine soja] KRH76170.1 hypothetical protein GLYMA_01G136500 [Glycine max] Length = 726 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLGG V+GGITQRLAARFLQQVLRVP TAS Sbjct: 693 EARRLGGRVVGGITQRLAARFLQQVLRVPTTAS 725 >XP_003521978.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like isoform X1 [Glycine max] KRH65378.1 hypothetical protein GLYMA_03G031700 [Glycine max] Length = 722 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EAR+LGG V+GGITQRLAARFLQQVLRVP TAS Sbjct: 689 EARQLGGRVVGGITQRLAARFLQQVLRVPTTAS 721 >KHN38818.1 Putative aarF domain-containing protein kinase, chloroplastic [Glycine soja] Length = 727 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EAR+LGG V+GGITQRLAARFLQQVLRVP TAS Sbjct: 694 EARQLGGRVVGGITQRLAARFLQQVLRVPTTAS 726 >XP_017442474.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Vigna angularis] XP_017442475.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Vigna angularis] XP_017442476.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Vigna angularis] KOM57653.1 hypothetical protein LR48_Vigan11g068600 [Vigna angularis] BAT97660.1 hypothetical protein VIGAN_09117500 [Vigna angularis var. angularis] Length = 719 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLGG V+ GITQRLAARFLQQ+LRVP+TAS Sbjct: 686 EARRLGGRVVSGITQRLAARFLQQILRVPSTAS 718 >XP_014492932.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Vigna radiata var. radiata] Length = 718 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EAR+LGG V+ GITQRLAARFLQQ+LRVP+TAS Sbjct: 685 EARKLGGRVVSGITQRLAARFLQQILRVPSTAS 717 >KHN25542.1 Putative aarF domain-containing protein kinase, chloroplastic [Glycine soja] Length = 622 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EARRLG VMGGITQRLAARFLQQVLRVP AS+ Sbjct: 589 EARRLGERVMGGITQRLAARFLQQVLRVPMPASS 622 >XP_003516816.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic isoform X1 [Glycine max] XP_003516817.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic isoform X1 [Glycine max] KRH75331.1 hypothetical protein GLYMA_01G079100 [Glycine max] KRH75332.1 hypothetical protein GLYMA_01G079100 [Glycine max] Length = 698 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EARRLG VMGGITQRLAARFLQQVLRVP AS+ Sbjct: 665 EARRLGERVMGGITQRLAARFLQQVLRVPMPASS 698 >XP_008233415.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Prunus mume] Length = 709 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EAR LGG V+GGITQRLAAR LQQVLRVP TAS Sbjct: 673 EARNLGGRVIGGITQRLAARLLQQVLRVPTTAS 705 >KYP53431.1 hypothetical protein KK1_024565 [Cajanus cajan] Length = 622 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLG VMGGITQRLAARFLQQVLRVP +S Sbjct: 589 EARRLGERVMGGITQRLAARFLQQVLRVPTPSS 621 >KCW70406.1 hypothetical protein EUGRSUZ_F03639 [Eucalyptus grandis] Length = 694 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EAR LGG V GGITQRLAAR LQQVLR+P TAST Sbjct: 658 EARSLGGRVAGGITQRLAARMLQQVLRLPPTAST 691 >XP_018731700.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Eucalyptus grandis] Length = 712 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EAR LGG V GGITQRLAAR LQQVLR+P TAST Sbjct: 676 EARSLGGRVAGGITQRLAARMLQQVLRLPPTAST 709 >KYP46463.1 hypothetical protein KK1_031919 [Cajanus cajan] Length = 719 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLGG V+GGITQRLAAR LQQVLRVP AS Sbjct: 686 EARRLGGRVVGGITQRLAARVLQQVLRVPTPAS 718 >GAU13022.1 hypothetical protein TSUD_173220 [Trifolium subterraneum] Length = 692 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 E RRLGG VM GITQR ARFLQQVLRVP TAS Sbjct: 659 EVRRLGGGVMDGITQRFVARFLQQVLRVPVTAS 691 >XP_014524035.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Vigna radiata var. radiata] Length = 697 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EARRLG VMGGITQRLAARFLQQVLRVP +++ Sbjct: 665 EARRLGERVMGGITQRLAARFLQQVLRVPTSST 697 >XP_015950602.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Arachis duranensis] Length = 729 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EARRLGG V+GGITQRLAARFLQQVLRV ++S+ Sbjct: 696 EARRLGGRVVGGITQRLAARFLQQVLRVQTSSSS 729 >XP_016184119.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Arachis ipaensis] Length = 731 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAST 237 EARRLGG V+GGITQRLAARFLQQVLRV ++S+ Sbjct: 698 EARRLGGRVVGGITQRLAARFLQQVLRVQTSSSS 731 >XP_009372672.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Pyrus x bretschneideri] XP_009372673.1 PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic [Pyrus x bretschneideri] Length = 707 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 338 EARRLGGSVMGGITQRLAARFLQQVLRVPATAS 240 EAR LGG V+GGITQRLAAR LQQVLRVP T S Sbjct: 671 EARNLGGRVVGGITQRLAARLLQQVLRVPTTVS 703