BLASTX nr result
ID: Glycyrrhiza33_contig00000600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00000600 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] 95 1e-23 BAO82212.1 hypothetical protein SRAA_2358 [Comamonadaceae bacter... 91 4e-22 BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multiv... 91 2e-21 CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella as... 87 2e-20 ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanic... 82 5e-18 OCA56495.1 hypothetical protein Phpb_00396 [Photorhabdus lumines... 72 2e-14 KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulga... 72 2e-14 KMW71018.1 hypothetical protein TI10_22595, partial [Photorhabdu... 72 3e-14 AID23550.1 hypothetical protein, partial [Phaeodactylum tricornu... 72 3e-14 EGG54195.1 hypothetical protein HMPREF9439_01522 [Parasutterella... 69 6e-13 EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter j... 67 1e-12 KGD55000.1 hypothetical protein DP49_5733 [Burkholderia pseudoma... 65 7e-12 CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] 61 2e-10 EES70918.1 hypothetical protein POTG_04459 [Paenibacillus sp. or... 61 3e-10 ACU24411.1 unknown, partial [Glycine max] 61 3e-10 CBX22841.1 unnamed protein product [Neisseria lactamica Y92-1009] 60 4e-10 CUQ87085.1 Uncharacterised protein [[Clostridium] innocuum] 63 1e-09 CDC86113.1 uncharacterized protein BN746_00004 [Erysipelotrichac... 63 1e-09 ADI17229.1 hypothetical protein, partial [uncultured alpha prote... 61 3e-09 KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] 62 1e-08 >CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] Length = 59 Score = 95.1 bits (235), Expect = 1e-23 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 235 QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRSPNIAKWETKWEG*NSQEVGLEAAIL 62 QTPNT EC+ G GANVR QEGNNPDRQLRS NIAKWETKWEG +SQEVGLEAA L Sbjct: 2 QTPNTGECSAGDSAPGANVRTQEGNNPDRQLRSLNIAKWETKWEGIDSQEVGLEAATL 59 >BAO82212.1 hypothetical protein SRAA_2358 [Comamonadaceae bacterium A1] BAO82213.1 hypothetical protein SRAA_2359 [Comamonadaceae bacterium A1] BAO84599.1 hypothetical protein SMCB_2371 [Comamonadaceae bacterium B1] BAO84600.1 hypothetical protein SMCB_2372 [Comamonadaceae bacterium B1] Length = 59 Score = 91.3 bits (225), Expect = 4e-22 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 235 QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRSPNIAKWETKWEG*NSQEVGLEAAIL 62 QTPNT+E + G + GANVR QEGNNPDRQLRS +AKWETKWEG NSQ+VGLEAAI+ Sbjct: 2 QTPNTDEYSLGDRAPGANVRTQEGNNPDRQLRSLKLAKWETKWEGYNSQDVGLEAAII 59 >BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] Length = 123 Score = 91.3 bits (225), Expect = 2e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT Sbjct: 83 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 >CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella asinigenitalis 14/45] Length = 53 Score = 87.0 bits (214), Expect = 2e-20 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDC LPTSFPT Sbjct: 13 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCLCLPTSFPT 53 >ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1] Length = 98 Score = 82.0 bits (201), Expect = 5e-18 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLHLPRR TR VSYYAFFKGWLLLSQPP C SLPTSFPT Sbjct: 58 LAPLHLPRRPTRLVSYYAFFKGWLLLSQPPSCLSLPTSFPT 98 >OCA56495.1 hypothetical protein Phpb_00396 [Photorhabdus luminescens] Length = 51 Score = 71.6 bits (174), Expect = 2e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 130 IAKWETKWEG*NSQEVGLEAAIL*RKRNSSLIESSCAEDVTGL 2 + KWET WEG +SQ+VGLEAAI+ RKRNSSL+ES+CAEDVTGL Sbjct: 1 MVKWETMWEGPDSQDVGLEAAIIERKRNSSLVESACAEDVTGL 43 >KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulgaris subsp. vulgaris] Length = 79 Score = 72.4 bits (176), Expect = 2e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFP 120 LAPL+LPRR TR VSYYAFFKGWLLLSQPP C L TSFP Sbjct: 40 LAPLNLPRRPTRPVSYYAFFKGWLLLSQPPGCLCLSTSFP 79 >KMW71018.1 hypothetical protein TI10_22595, partial [Photorhabdus luminescens subsp. luminescens] Length = 65 Score = 71.6 bits (174), Expect = 3e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 130 IAKWETKWEG*NSQEVGLEAAIL*RKRNSSLIESSCAEDVTGL 2 + KWET WEG +SQ+VGLEAAI+ RKRNSSL+ES+CAEDVTGL Sbjct: 1 MVKWETMWEGPDSQDVGLEAAIIERKRNSSLVESACAEDVTGL 43 >AID23550.1 hypothetical protein, partial [Phaeodactylum tricornutum] Length = 73 Score = 71.6 bits (174), Expect = 3e-14 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = +1 Query: 16 LPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LPRR TR VSYYAFFKGWLLLSQPP C SLPTSFPT Sbjct: 38 LPRRPTRLVSYYAFFKGWLLLSQPPSCLSLPTSFPT 73 >EGG54195.1 hypothetical protein HMPREF9439_01522 [Parasutterella excrementihominis YIT 11859] Length = 75 Score = 68.6 bits (166), Expect = 6e-13 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLHLPRR TR VSYYAFF+GWLLLSQ P C L TSF T Sbjct: 35 LAPLHLPRRRTRPVSYYAFFEGWLLLSQLPGCHGLSTSFST 75 >EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter jejuni subsp. jejuni 1336] Length = 51 Score = 67.0 bits (162), Expect = 1e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPL+ PR+ TR VSYYAFFKGWLLLSQPP C S TSF T Sbjct: 11 LAPLYFPRKITRPVSYYAFFKGWLLLSQPPGCLSNFTSFST 51 >KGD55000.1 hypothetical protein DP49_5733 [Burkholderia pseudomallei] Length = 36 Score = 64.7 bits (156), Expect = 7e-12 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 210 LHSSVFGVCYGVVIRNGPHNHDSALPPKVIHEALPK 317 +HSSVFGVCYG VI N P NHDSALPPKV HEALPK Sbjct: 1 MHSSVFGVCYGGVICNRPPNHDSALPPKVRHEALPK 36 >CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] Length = 51 Score = 61.2 bits (147), Expect = 2e-10 Identities = 29/41 (70%), Positives = 29/41 (70%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLH RR TR VSYYA FK WLLLSQ P C TSFPT Sbjct: 11 LAPLHFRRRVTRPVSYYALFKWWLLLSQHPGCLGNSTSFPT 51 >EES70918.1 hypothetical protein POTG_04459 [Paenibacillus sp. oral taxon 786 str. D14] Length = 44 Score = 60.8 bits (146), Expect = 3e-10 Identities = 29/41 (70%), Positives = 29/41 (70%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAPLH RR TR VSYYA FK WLLLSQ P C TSFPT Sbjct: 4 LAPLHFRRRVTRPVSYYALFKWWLLLSQHPGCLCNSTSFPT 44 >ACU24411.1 unknown, partial [Glycine max] Length = 64 Score = 61.2 bits (147), Expect = 3e-10 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 L+P+HL R++ RSVSYYA F+GWLLL +PP C PTSF T Sbjct: 15 LSPVHLRRKSARSVSYYALFQGWLLLGKPPGCLCTPTSFIT 55 >CBX22841.1 unnamed protein product [Neisseria lactamica Y92-1009] Length = 49 Score = 60.5 bits (145), Expect = 4e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 262 GPLRITTP*QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRSPNI 128 G L++T P QT NT + GRQT+GANVRCQEGNNPDR+LRS I Sbjct: 4 GLLQLTNPWQTQNTIKWFLGRQTAGANVRCQEGNNPDRRLRSQMI 48 >CUQ87085.1 Uncharacterised protein [[Clostridium] innocuum] Length = 219 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAP+H RR TR VS YA F+GWLLLSQPP C +PTSF T Sbjct: 179 LAPVHFRRRVTRLVSCYALFEGWLLLSQPPSCLCIPTSFST 219 >CDC86113.1 uncharacterized protein BN746_00004 [Erysipelotrichaceae bacterium CAG:64] Length = 219 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 LAP+H RR TR VS YA F+GWLLLSQPP C +PTSF T Sbjct: 179 LAPVHFRRRVTRLVSCYALFEGWLLLSQPPSCLCIPTSFST 219 >ADI17229.1 hypothetical protein, partial [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 60.8 bits (146), Expect = 3e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 31 TRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 +R VSYYAFFKGWLLLSQPP C LPTSFPT Sbjct: 109 SRPVSYYAFFKGWLLLSQPPGCLGLPTSFPT 139 >KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] Length = 345 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 1 LAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 L+P+HL ++ RSVSYYAFF+GWLLL +PP C PTSF T Sbjct: 238 LSPVHLRHKSARSVSYYAFFQGWLLLGKPPGCLCTPTSFIT 278