BLASTX nr result
ID: Glycyrrhiza32_contig00040132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00040132 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN40507.1 Transcription factor bHLH25 [Glycine soja] 53 3e-06 XP_003626782.1 helix loop helix DNA-binding domain protein [Medi... 52 7e-06 >KHN40507.1 Transcription factor bHLH25 [Glycine soja] Length = 269 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +1 Query: 61 FGASTLKITIIAQMEDEYSMTIDDLVKNLRKEL 159 FG+STLKITII+QM+DEY+MT+DDLV+ LR+ + Sbjct: 229 FGSSTLKITIISQMDDEYNMTLDDLVRTLRQRI 261 >XP_003626782.1 helix loop helix DNA-binding domain protein [Medicago truncatula] AET01258.1 helix loop helix DNA-binding domain protein [Medicago truncatula] Length = 332 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +1 Query: 61 FGASTLKITIIAQMEDEYSMTIDDLVKNLRKELQQ 165 FG+STLK+TIIAQM+DEY M+++DLV NLR+ L + Sbjct: 289 FGSSTLKVTIIAQMDDEYCMSMNDLVNNLRQNLME 323