BLASTX nr result
ID: Glycyrrhiza32_contig00039975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039975 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU17465.1 hypothetical protein TSUD_143190 [Trifolium subterran... 58 1e-08 >GAU17465.1 hypothetical protein TSUD_143190 [Trifolium subterraneum] Length = 133 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +3 Query: 3 RTRLLSENVEALMCCRNWLHDFHDDEYDSDEEDGKCLRGEQQISKGASNVIDVD 164 R RLLS+NVEAL+C RNWLH F ++ D D++DGK SK ASN + VD Sbjct: 80 RNRLLSDNVEALLCTRNWLHGFVSNDDDDDDDDGK--DASPSTSKQASNSVVVD 131