BLASTX nr result
ID: Glycyrrhiza32_contig00039959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039959 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT83568.1 hypothetical protein VIGAN_04073400 [Vigna angularis ... 68 3e-12 XP_017418158.1 PREDICTED: probable WRKY transcription factor 43 ... 68 6e-12 KHN29308.1 Putative WRKY transcription factor 24 [Glycine soja] 68 8e-12 XP_003552423.1 PREDICTED: probable WRKY transcription factor 43 ... 68 8e-12 XP_003534536.1 PREDICTED: probable WRKY transcription factor 43 ... 68 8e-12 ABS18452.1 transcription factor, partial [Glycine max] 68 8e-12 XP_004492806.1 PREDICTED: probable WRKY transcription factor 12 ... 68 1e-11 XP_004492805.1 PREDICTED: probable WRKY transcription factor 12 ... 68 1e-11 XP_003624078.1 WRKY family transcription factor [Medicago trunca... 68 1e-11 KYP47603.1 putative WRKY transcription factor 24 [Cajanus cajan] 67 1e-11 XP_014496824.1 PREDICTED: probable WRKY transcription factor 56 ... 67 4e-11 BAT98005.1 hypothetical protein VIGAN_09160600 [Vigna angularis ... 65 5e-11 XP_015899561.1 PREDICTED: probable WRKY transcription factor 43 ... 62 6e-11 XP_015947794.1 PREDICTED: probable WRKY transcription factor 43 ... 65 6e-11 XP_017441991.1 PREDICTED: probable WRKY transcription factor 24 ... 65 7e-11 XP_015961857.1 PREDICTED: probable WRKY transcription factor 24 ... 66 8e-11 AFK47497.1 unknown [Medicago truncatula] 65 9e-11 XP_016179808.1 PREDICTED: probable WRKY transcription factor 24 ... 65 1e-10 XP_007139776.1 hypothetical protein PHAVU_008G0580001g, partial ... 61 1e-10 AMO00399.1 WRKY transcription factor 31 [Manihot esculenta] 64 2e-10 >BAT83568.1 hypothetical protein VIGAN_04073400 [Vigna angularis var. angularis] Length = 147 Score = 67.8 bits (164), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 117 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 147 >XP_017418158.1 PREDICTED: probable WRKY transcription factor 43 [Vigna angularis] KOM37058.1 hypothetical protein LR48_Vigan03g043900 [Vigna angularis] Length = 182 Score = 67.8 bits (164), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 152 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 182 >KHN29308.1 Putative WRKY transcription factor 24 [Glycine soja] Length = 192 Score = 67.8 bits (164), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 162 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 192 >XP_003552423.1 PREDICTED: probable WRKY transcription factor 43 [Glycine max] KRH00862.1 hypothetical protein GLYMA_18G238600 [Glycine max] Length = 192 Score = 67.8 bits (164), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 162 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 192 >XP_003534536.1 PREDICTED: probable WRKY transcription factor 43 [Glycine max] KRH40372.1 hypothetical protein GLYMA_09G254400 [Glycine max] Length = 192 Score = 67.8 bits (164), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 162 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 192 >ABS18452.1 transcription factor, partial [Glycine max] Length = 195 Score = 67.8 bits (164), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 165 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 195 >XP_004492806.1 PREDICTED: probable WRKY transcription factor 12 isoform X2 [Cicer arietinum] Length = 213 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 183 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 213 >XP_004492805.1 PREDICTED: probable WRKY transcription factor 12 isoform X1 [Cicer arietinum] Length = 214 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 184 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 214 >XP_003624078.1 WRKY family transcription factor [Medicago truncatula] AES80296.1 WRKY family transcription factor [Medicago truncatula] Length = 219 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL Sbjct: 189 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 219 >KYP47603.1 putative WRKY transcription factor 24 [Cajanus cajan] Length = 163 Score = 66.6 bits (161), Expect = 1e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLA+L Sbjct: 133 TTYEGIHNHPCEKLMETLTPLLKQIQFLATL 163 >XP_014496824.1 PREDICTED: probable WRKY transcription factor 56 [Vigna radiata var. radiata] Length = 228 Score = 66.6 bits (161), Expect = 4e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQI+FLASL Sbjct: 198 TTYEGIHNHPCEKLMETLTPLLKQIEFLASL 228 >BAT98005.1 hypothetical protein VIGAN_09160600 [Vigna angularis var. angularis] Length = 187 Score = 65.5 bits (158), Expect = 5e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQ+QFL+SL Sbjct: 145 TTYEGIHNHPCEKLMETLTPLLKQMQFLSSL 175 >XP_015899561.1 PREDICTED: probable WRKY transcription factor 43 [Ziziphus jujuba] Length = 67 Score = 62.4 bits (150), Expect = 6e-11 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLA 89 TTYEGIHNHPCEKLMETLTPLLKQ+QFL+ Sbjct: 37 TTYEGIHNHPCEKLMETLTPLLKQMQFLS 65 >XP_015947794.1 PREDICTED: probable WRKY transcription factor 43 [Arachis duranensis] Length = 178 Score = 65.1 bits (157), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLAS 92 TTYEGIHNHPCEKLMETLTPLLKQ+QFLAS Sbjct: 148 TTYEGIHNHPCEKLMETLTPLLKQMQFLAS 177 >XP_017441991.1 PREDICTED: probable WRKY transcription factor 24 [Vigna angularis] Length = 205 Score = 65.5 bits (158), Expect = 7e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQ+QFL+SL Sbjct: 163 TTYEGIHNHPCEKLMETLTPLLKQMQFLSSL 193 >XP_015961857.1 PREDICTED: probable WRKY transcription factor 24 isoform X1 [Arachis duranensis] Length = 237 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQFLA++ Sbjct: 207 TTYEGIHNHPCEKLMETLTPLLKQIQFLATI 237 >AFK47497.1 unknown [Medicago truncatula] Length = 219 Score = 65.5 bits (158), Expect = 9e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLASL 95 TTYEGIHNHPCEKLMETLTPLLKQIQ LASL Sbjct: 189 TTYEGIHNHPCEKLMETLTPLLKQIQLLASL 219 >XP_016179808.1 PREDICTED: probable WRKY transcription factor 24 [Arachis ipaensis] Length = 228 Score = 65.1 bits (157), Expect = 1e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLAS 92 TTYEGIHNHPCEKLMETLTPLLKQ+QFLAS Sbjct: 198 TTYEGIHNHPCEKLMETLTPLLKQMQFLAS 227 >XP_007139776.1 hypothetical protein PHAVU_008G0580001g, partial [Phaseolus vulgaris] ESW11770.1 hypothetical protein PHAVU_008G0580001g, partial [Phaseolus vulgaris] Length = 58 Score = 61.2 bits (147), Expect = 1e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLAS 92 TTYEGIHNHPCEKLMETLTPLL QI FLA+ Sbjct: 28 TTYEGIHNHPCEKLMETLTPLLNQIHFLAT 57 >AMO00399.1 WRKY transcription factor 31 [Manihot esculenta] Length = 171 Score = 63.9 bits (154), Expect = 2e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 TTYEGIHNHPCEKLMETLTPLLKQIQFLAS 92 TTYEGIHNHPCEKLMETLTPLLKQ+QFL+S Sbjct: 141 TTYEGIHNHPCEKLMETLTPLLKQMQFLSS 170