BLASTX nr result
ID: Glycyrrhiza32_contig00039891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039891 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM42631.1 hypothetical protein LR48_Vigan05g023500 [Vigna angul... 55 5e-07 >KOM42631.1 hypothetical protein LR48_Vigan05g023500 [Vigna angularis] Length = 2066 Score = 55.1 bits (131), Expect = 5e-07 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +1 Query: 115 CCVQSLNSLVILSMED-NEWDLYNHDPLLLTDVSLQQKIS 231 C S NSLVIL+MED N+W Y+HDPLLLTDVSLQQ+ S Sbjct: 1003 CTFYSSNSLVILTMEDTNQWRRYDHDPLLLTDVSLQQESS 1042