BLASTX nr result
ID: Glycyrrhiza32_contig00039406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039406 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003627859.1 PPR containing plant-like protein [Medicago trunc... 94 7e-20 XP_004511038.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 3e-18 GAU37602.1 hypothetical protein TSUD_365230 [Trifolium subterran... 87 2e-17 XP_019453492.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 XP_007133767.1 hypothetical protein PHAVU_011G207300g [Phaseolus... 80 6e-15 KHN27334.1 Pentatricopeptide repeat-containing protein [Glycine ... 79 1e-14 XP_003545840.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-14 KYP37911.1 Pentatricopeptide repeat-containing protein At5g38730... 77 4e-14 XP_016183783.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 4e-14 XP_015950156.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 4e-14 XP_017431437.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 1e-13 KRH20743.1 hypothetical protein GLYMA_13G197700 [Glycine max] KR... 75 2e-13 KHN37665.1 Pentatricopeptide repeat-containing protein [Glycine ... 75 2e-13 XP_006594395.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 XP_014522800.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 4e-13 XP_007208255.1 hypothetical protein PRUPE_ppa016546mg [Prunus pe... 59 9e-08 OMO87054.1 hypothetical protein CCACVL1_09287 [Corchorus capsula... 54 2e-06 OMO52692.1 hypothetical protein COLO4_37044 [Corchorus olitorius] 54 4e-06 OMO81314.1 hypothetical protein COLO4_23655 [Corchorus olitorius] 54 5e-06 XP_015880462.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 5e-06 >XP_003627859.1 PPR containing plant-like protein [Medicago truncatula] AET02335.1 PPR containing plant-like protein [Medicago truncatula] Length = 731 Score = 94.0 bits (232), Expect = 7e-20 Identities = 54/90 (60%), Positives = 57/90 (63%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI**QSCCLSN 231 RRLM+ KIYRCFS D S+NKVSQMFWDHVVERGLMSRNTM KIQQM Sbjct: 542 RRLMITVKIYRCFSALD-ASQNKVSQMFWDHVVERGLMSRNTMYKIQQMPF--------- 591 Query: 232 PSRLEDSSYNCRLCIASGYQRVFLHVFTDH 321 I+SGYQRVFLHVFT H Sbjct: 592 --------------ISSGYQRVFLHVFTCH 607 >XP_004511038.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] XP_012574242.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] XP_012574243.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] Length = 588 Score = 89.4 bits (220), Expect = 3e-18 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 R LM+NAKIYRCFS PD GSE KVSQMFWDHVVERGLMSRNTM KIQQMLI Sbjct: 539 RMLMINAKIYRCFSAPD-GSETKVSQMFWDHVVERGLMSRNTMYKIQQMLI 588 >GAU37602.1 hypothetical protein TSUD_365230 [Trifolium subterraneum] Length = 488 Score = 87.0 bits (214), Expect = 2e-17 Identities = 45/60 (75%), Positives = 48/60 (80%) Frame = +1 Query: 25 SGIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 S I+ RRLM+ KIYRCFS PD SENKVSQMFWDH+VERGLMSRNTM KIQQMLI Sbjct: 430 SNILDEMARRRLMVTVKIYRCFSAPD-ASENKVSQMFWDHLVERGLMSRNTMYKIQQMLI 488 >XP_019453492.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Lupinus angustifolius] OIW06171.1 hypothetical protein TanjilG_01798 [Lupinus angustifolius] Length = 587 Score = 86.3 bits (212), Expect = 3e-17 Identities = 44/63 (69%), Positives = 49/63 (77%) Frame = +1 Query: 10 KCHRCSGIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKI 189 K S ++ RRLM+ AKIYRCFSD DD S NKVSQ+FWDHVVERGLMSRNTMNKI Sbjct: 524 KSRAASNMLEEMARRRLMITAKIYRCFSDVDD-SGNKVSQIFWDHVVERGLMSRNTMNKI 582 Query: 190 QQM 198 +QM Sbjct: 583 RQM 585 >XP_007133767.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] XP_007133768.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] XP_007133769.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] ESW05761.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] ESW05762.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] ESW05763.1 hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] Length = 587 Score = 79.7 bits (195), Expect = 6e-15 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +1 Query: 28 GIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 G++ RRLM+ K+YRCFS D SENKVS +FW+HVV+RGLMSRN+MNKIQQMLI Sbjct: 530 GVLEEMTRRRLMITVKLYRCFST-SDASENKVSLLFWNHVVDRGLMSRNSMNKIQQMLI 587 >KHN27334.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 401 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D +ENKVSQ+FW+HV++RGLMSRNTMNKIQQ LI Sbjct: 352 RRLMITVKLYRCFST-SDANENKVSQIFWNHVMDRGLMSRNTMNKIQQKLI 401 >XP_003545840.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] KRH13392.1 hypothetical protein GLYMA_15G236300 [Glycine max] KRH13393.1 hypothetical protein GLYMA_15G236300 [Glycine max] Length = 587 Score = 78.6 bits (192), Expect = 2e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D +ENKVSQ+FW+HV++RGLMSRNTMNKIQQ LI Sbjct: 538 RRLMITVKLYRCFST-SDANENKVSQIFWNHVMDRGLMSRNTMNKIQQKLI 587 >KYP37911.1 Pentatricopeptide repeat-containing protein At5g38730 family [Cajanus cajan] Length = 588 Score = 77.4 bits (189), Expect = 4e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D SENKV Q+FW+HVV+RGLMSRNTMNKIQQ+L+ Sbjct: 539 RRLMITVKLYRCFSTSDT-SENKVLQIFWNHVVDRGLMSRNTMNKIQQILM 588 >XP_016183783.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Arachis ipaensis] Length = 602 Score = 77.4 bits (189), Expect = 4e-14 Identities = 36/60 (60%), Positives = 44/60 (73%) Frame = +1 Query: 25 SGIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 S ++ +RLM+ K+YRC DD SE+KV Q+FWDHVV+ GLMSRNTMNKIQQM I Sbjct: 543 SNVLVEMARKRLMITIKLYRCIRGADDNSESKVLQIFWDHVVDLGLMSRNTMNKIQQMAI 602 >XP_015950156.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Arachis duranensis] Length = 602 Score = 77.4 bits (189), Expect = 4e-14 Identities = 36/60 (60%), Positives = 44/60 (73%) Frame = +1 Query: 25 SGIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 S ++ +RLM+ K+YRC DD SE+KV Q+FWDHVV+ GLMSRNTMNKIQQM I Sbjct: 543 SNVLVEMARKRLMITIKLYRCIRGADDNSESKVLQIFWDHVVDLGLMSRNTMNKIQQMAI 602 >XP_017431437.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vigna angularis] XP_017431438.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vigna angularis] KOM49220.1 hypothetical protein LR48_Vigan08g004700 [Vigna angularis] BAT89265.1 hypothetical protein VIGAN_06018000 [Vigna angularis var. angularis] Length = 587 Score = 75.9 bits (185), Expect = 1e-13 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +1 Query: 28 GIMWWKGARRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 G++ RRLM+ K+YRCFS D EN+VS +FW+HVV+RGLMSRN+MNKIQQMLI Sbjct: 530 GVLEEMTRRRLMITVKLYRCFST-SDARENEVSLIFWNHVVDRGLMSRNSMNKIQQMLI 587 >KRH20743.1 hypothetical protein GLYMA_13G197700 [Glycine max] KRH20744.1 hypothetical protein GLYMA_13G197700 [Glycine max] KRH20745.1 hypothetical protein GLYMA_13G197700 [Glycine max] Length = 447 Score = 75.5 bits (184), Expect = 2e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D ENKVSQ FW+HVV+RGLMSRNTM KIQQ LI Sbjct: 398 RRLMITVKLYRCFST-SDAHENKVSQFFWNHVVDRGLMSRNTMYKIQQKLI 447 >KHN37665.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 492 Score = 75.5 bits (184), Expect = 2e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D ENKVSQ FW+HVV+RGLMSRNTM KIQQ LI Sbjct: 443 RRLMITVKLYRCFST-SDAHENKVSQFFWNHVVDRGLMSRNTMYKIQQKLI 492 >XP_006594395.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] XP_006594396.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] XP_006594397.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] KRH20741.1 hypothetical protein GLYMA_13G197700 [Glycine max] KRH20742.1 hypothetical protein GLYMA_13G197700 [Glycine max] Length = 587 Score = 75.5 bits (184), Expect = 2e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 RRLM+ K+YRCFS D ENKVSQ FW+HVV+RGLMSRNTM KIQQ LI Sbjct: 538 RRLMITVKLYRCFST-SDAHENKVSQFFWNHVVDRGLMSRNTMYKIQQKLI 587 >XP_014522800.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vigna radiata var. radiata] Length = 587 Score = 74.7 bits (182), Expect = 4e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQMLI 204 R LM+ K+YRCFS D ENKVS +FW+HVV+RGLMSRN+MNKIQQMLI Sbjct: 538 RTLMITVKLYRCFST-SDARENKVSLIFWNHVVDRGLMSRNSMNKIQQMLI 587 >XP_007208255.1 hypothetical protein PRUPE_ppa016546mg [Prunus persica] ONI02236.1 hypothetical protein PRUPE_6G186200 [Prunus persica] ONI02237.1 hypothetical protein PRUPE_6G186200 [Prunus persica] Length = 589 Score = 59.3 bits (142), Expect = 9e-08 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQ 195 RRLM+ KIYRCF+ S+N + ++FWDH+VERGLMS+N +NK Q Sbjct: 541 RRLMVTRKIYRCFN-ASYASDNDIIRLFWDHMVERGLMSKNVINKEMQ 587 >OMO87054.1 hypothetical protein CCACVL1_09287 [Corchorus capsularis] Length = 197 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQ 195 RRLM+ KIYRCFS G +N + FW+HVVERGLMS++ + I+Q Sbjct: 143 RRLMITLKIYRCFSASYAG-DNSILGFFWNHVVERGLMSKSILKDIEQ 189 >OMO52692.1 hypothetical protein COLO4_37044 [Corchorus olitorius] Length = 310 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQ 195 RRLM+ KIYRCFS G +N + FW+HVVERGLMS++ + I+Q Sbjct: 256 RRLMITLKIYRCFSASYAG-DNSILGFFWNHVVERGLMSKSILKDIEQ 302 >OMO81314.1 hypothetical protein COLO4_23655 [Corchorus olitorius] Length = 512 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQ 195 RRLM+ KIYRCFS G +N + FW+HVVERGLMS++ + I+Q Sbjct: 458 RRLMITLKIYRCFSASYAG-DNSILGFFWNHVVERGLMSKSILKDIEQ 504 >XP_015880462.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Ziziphus jujuba] Length = 589 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 52 RRLMMNAKIYRCFSDPDDGSENKVSQMFWDHVVERGLMSRNTMNKIQQ 195 RRL++ KIY CF+ S+ + ++FWDHV+ERGLMS+ +NK+QQ Sbjct: 542 RRLLITRKIYECFN-ASYASDYDIIRVFWDHVIERGLMSKGIINKMQQ 588