BLASTX nr result
ID: Glycyrrhiza32_contig00039212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039212 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35289.1 hypothetical protein TSUD_274910 [Trifolium subterran... 75 2e-14 XP_007151202.1 hypothetical protein PHAVU_004G026500g [Phaseolus... 76 1e-13 XP_013450933.1 auxin efflux carrier family transporter [Medicago... 76 1e-13 KYP49889.1 Putative auxin efflux carrier component 5 [Cajanus ca... 75 3e-13 XP_014506643.1 PREDICTED: putative auxin efflux carrier componen... 75 3e-13 KOM56693.1 hypothetical protein LR48_Vigan10g258500 [Vigna angul... 75 3e-13 OIW06704.1 hypothetical protein TanjilG_04098 [Lupinus angustifo... 73 5e-13 KRH58175.1 hypothetical protein GLYMA_05G109800 [Glycine max] 73 9e-13 KRH58176.1 hypothetical protein GLYMA_05G109800 [Glycine max] 73 1e-12 KHN47561.1 Putative auxin efflux carrier component 5 [Glycine soja] 73 1e-12 NP_001267507.1 uncharacterized protein LOC100795531 [Glycine max... 73 1e-12 XP_003550957.1 PREDICTED: uncharacterized protein LOC100789817 i... 73 1e-12 XP_004489373.1 PREDICTED: putative auxin efflux carrier componen... 73 1e-12 NP_001276163.1 uncharacterized protein LOC100789817 [Glycine max... 73 1e-12 XP_019452939.1 PREDICTED: auxin efflux carrier component 8 [Lupi... 73 1e-12 XP_016179145.1 PREDICTED: putative auxin efflux carrier componen... 73 1e-12 XP_015945987.1 PREDICTED: putative auxin efflux carrier componen... 73 1e-12 XP_019091226.1 PREDICTED: auxin efflux carrier component 7-like ... 69 2e-12 XP_006451623.1 hypothetical protein CICLE_v100077871mg, partial ... 67 2e-12 BAD93921.1 auxin transporter splice variant b [Arabidopsis thali... 69 6e-12 >GAU35289.1 hypothetical protein TSUD_274910 [Trifolium subterraneum] Length = 186 Score = 75.5 bits (184), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHPA+LSTGVLLGMLIALPVAL YYL+LSL Sbjct: 148 PFVFAREYNVHPAILSTGVLLGMLIALPVALIYYLILSL 186 >XP_007151202.1 hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris] ESW23196.1 hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris] Length = 361 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHP +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 321 PFVFAREYNVHPGILSTGVLLGMLMALPVALTYYLLLSL 359 >XP_013450933.1 auxin efflux carrier family transporter [Medicago truncatula] AGJ95049.1 PIN11 [Medicago truncatula] KEH24973.1 auxin efflux carrier family transporter [Medicago truncatula] Length = 361 Score = 75.9 bits (185), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHPAVLSTGVLLGMLIALPVAL YYLLLS+ Sbjct: 323 PFVFAREYNVHPAVLSTGVLLGMLIALPVALIYYLLLSI 361 >KYP49889.1 Putative auxin efflux carrier component 5 [Cajanus cajan] Length = 362 Score = 74.7 bits (182), Expect = 3e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHP +LSTGVLLGML+ALPVALTYY+LLSL Sbjct: 324 PFVFAREYNVHPGILSTGVLLGMLMALPVALTYYVLLSL 362 >XP_014506643.1 PREDICTED: putative auxin efflux carrier component 5 [Vigna radiata var. radiata] Length = 362 Score = 74.7 bits (182), Expect = 3e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHP +LSTGVLLGML+ALPVALTYY+LLSL Sbjct: 322 PFVFAREYNVHPGILSTGVLLGMLMALPVALTYYVLLSL 360 >KOM56693.1 hypothetical protein LR48_Vigan10g258500 [Vigna angularis] BAU01206.1 hypothetical protein VIGAN_11039000 [Vigna angularis var. angularis] Length = 363 Score = 74.7 bits (182), Expect = 3e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNVHP +LSTGVLLGML+ALPVALTYY+LLSL Sbjct: 323 PFVFAREYNVHPGILSTGVLLGMLMALPVALTYYVLLSL 361 >OIW06704.1 hypothetical protein TanjilG_04098 [Lupinus angustifolius] Length = 246 Score = 72.8 bits (177), Expect = 5e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL*H 262 PFVFA+EYNVHPA+LSTGVLLGMLIALPV LTYY++L + H Sbjct: 204 PFVFAKEYNVHPAILSTGVLLGMLIALPVTLTYYVILEVGH 244 >KRH58175.1 hypothetical protein GLYMA_05G109800 [Glycine max] Length = 335 Score = 73.2 bits (178), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 296 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 334 >KRH58176.1 hypothetical protein GLYMA_05G109800 [Glycine max] Length = 361 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 322 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 360 >KHN47561.1 Putative auxin efflux carrier component 5 [Glycine soja] Length = 362 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 323 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 361 >NP_001267507.1 uncharacterized protein LOC100795531 [Glycine max] AGJ95051.1 PIN11a [Glycine max] KRH58174.1 hypothetical protein GLYMA_05G109800 [Glycine max] Length = 362 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 323 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 361 >XP_003550957.1 PREDICTED: uncharacterized protein LOC100789817 isoform X1 [Glycine max] KHN01714.1 Putative auxin efflux carrier component 5 [Glycine soja] KRH04363.1 hypothetical protein GLYMA_17G157300 [Glycine max] Length = 363 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 324 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 362 >XP_004489373.1 PREDICTED: putative auxin efflux carrier component 5 [Cicer arietinum] Length = 364 Score = 73.2 bits (178), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV PA+LSTGVLLGMLIALPVAL YYLLLSL Sbjct: 326 PFVFAREYNVQPAILSTGVLLGMLIALPVALIYYLLLSL 364 >NP_001276163.1 uncharacterized protein LOC100789817 [Glycine max] AGJ95066.1 PIN11b [Glycine max] Length = 432 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFAREYNV+P +LSTGVLLGML+ALPVALTYYLLLSL Sbjct: 393 PFVFAREYNVNPGILSTGVLLGMLMALPVALTYYLLLSL 431 >XP_019452939.1 PREDICTED: auxin efflux carrier component 8 [Lupinus angustifolius] Length = 367 Score = 72.8 bits (177), Expect = 1e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL*H 262 PFVFA+EYNVHPA+LSTGVLLGMLIALPV LTYY++L + H Sbjct: 325 PFVFAKEYNVHPAILSTGVLLGMLIALPVTLTYYVILEVGH 365 >XP_016179145.1 PREDICTED: putative auxin efflux carrier component 5 [Arachis ipaensis] Length = 368 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFA+EYNV+P+VLSTGVLLGML+ALPVALTYYL+LSL Sbjct: 330 PFVFAKEYNVNPSVLSTGVLLGMLVALPVALTYYLMLSL 368 >XP_015945987.1 PREDICTED: putative auxin efflux carrier component 5 [Arachis duranensis] Length = 368 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFA+EYNV+P+VLSTGVLLGML+ALPVALTYYL+LSL Sbjct: 330 PFVFAKEYNVNPSVLSTGVLLGMLVALPVALTYYLMLSL 368 >XP_019091226.1 PREDICTED: auxin efflux carrier component 7-like [Camelina sativa] Length = 124 Score = 68.9 bits (167), Expect = 2e-12 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFA+EYNVHPA+LSTGV+ GMLIALP+ L YY+LL L Sbjct: 86 PFVFAKEYNVHPAILSTGVIFGMLIALPITLVYYILLGL 124 >XP_006451623.1 hypothetical protein CICLE_v100077871mg, partial [Citrus clementina] ESR64863.1 hypothetical protein CICLE_v100077871mg, partial [Citrus clementina] Length = 47 Score = 66.6 bits (161), Expect = 2e-12 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFA+EYNVHP +LSTGV+ GMLIALP+ L YY+LL L Sbjct: 9 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 47 >BAD93921.1 auxin transporter splice variant b [Arabidopsis thaliana] Length = 191 Score = 68.9 bits (167), Expect = 6e-12 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 384 PFVFAREYNVHPAVLSTGVLLGMLIALPVALTYYLLLSL 268 PFVFA+EYNVHP +LSTGV+LGMLIALP+ L YY+LL L Sbjct: 153 PFVFAKEYNVHPTILSTGVILGMLIALPITLVYYILLGL 191