BLASTX nr result
ID: Glycyrrhiza32_contig00039117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039117 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015945636.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 55 8e-07 XP_016182463.1 PREDICTED: uncharacterized protein LOC107624487 [... 55 8e-07 XP_004136217.1 PREDICTED: U-box domain-containing protein 26 [Cu... 54 2e-06 XP_008466051.1 PREDICTED: U-box domain-containing protein 26 [Cu... 54 2e-06 XP_010100255.1 hypothetical protein L484_007252 [Morus notabilis... 53 3e-06 KYP65172.1 U-box domain-containing protein 26 [Cajanus cajan] 53 3e-06 XP_018845434.1 PREDICTED: U-box domain-containing protein 25 [Ju... 53 4e-06 XP_003527831.1 PREDICTED: uncharacterized protein LOC100814020 [... 52 5e-06 XP_017409170.1 PREDICTED: drebrin [Vigna angularis] KOM28643.1 h... 52 5e-06 XP_014500459.1 PREDICTED: uncharacterized protein LOC106761420 [... 52 5e-06 XP_007137194.1 hypothetical protein PHAVU_009G107700g [Phaseolus... 52 5e-06 >XP_015945636.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC107470738 [Arachis duranensis] Length = 301 Score = 54.7 bits (130), Expect = 8e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 MK HQPKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKPHQPKLKTQLFSCGFFRHCAQTV 25 >XP_016182463.1 PREDICTED: uncharacterized protein LOC107624487 [Arachis ipaensis] Length = 326 Score = 54.7 bits (130), Expect = 8e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 MK HQPKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKPHQPKLKTQLFSCGFFRHCAQTV 25 >XP_004136217.1 PREDICTED: U-box domain-containing protein 26 [Cucumis sativus] KGN60328.1 hypothetical protein Csa_3G895740 [Cucumis sativus] Length = 324 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 M+THQPKLKTQLFSCGFFRHC +SV Sbjct: 1 MRTHQPKLKTQLFSCGFFRHCTRSV 25 >XP_008466051.1 PREDICTED: U-box domain-containing protein 26 [Cucumis melo] Length = 326 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 M+THQPKLKTQLFSCGFFRHC +SV Sbjct: 1 MRTHQPKLKTQLFSCGFFRHCTRSV 25 >XP_010100255.1 hypothetical protein L484_007252 [Morus notabilis] EXB82262.1 hypothetical protein L484_007252 [Morus notabilis] Length = 293 Score = 53.1 bits (126), Expect = 3e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 MK HQPKLKTQLFSCGFFRHC Q+V Sbjct: 1 MKPHQPKLKTQLFSCGFFRHCTQTV 25 >KYP65172.1 U-box domain-containing protein 26 [Cajanus cajan] Length = 310 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 100 THNHHSTMKTHQPKLKTQLFSCGFFRHCAQSV 195 TH+HH QPKLKTQLFSCGFFRHCAQ+V Sbjct: 3 THHHH------QPKLKTQLFSCGFFRHCAQTV 28 >XP_018845434.1 PREDICTED: U-box domain-containing protein 25 [Juglans regia] Length = 326 Score = 52.8 bits (125), Expect = 4e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 121 MKTHQPKLKTQLFSCGFFRHCAQSV 195 MKT+QPKLKTQLFSCGFFRHC Q+V Sbjct: 1 MKTNQPKLKTQLFSCGFFRHCTQTV 25 >XP_003527831.1 PREDICTED: uncharacterized protein LOC100814020 [Glycine max] KRH52713.1 hypothetical protein GLYMA_06G083600 [Glycine max] Length = 307 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = +1 Query: 121 MKTHQ-PKLKTQLFSCGFFRHCAQSV 195 MKTHQ PKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKTHQQPKLKTQLFSCGFFRHCAQTV 26 >XP_017409170.1 PREDICTED: drebrin [Vigna angularis] KOM28643.1 hypothetical protein LR48_Vigan561s003300 [Vigna angularis] BAT78323.1 hypothetical protein VIGAN_02098500 [Vigna angularis var. angularis] Length = 313 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = +1 Query: 121 MKTHQ-PKLKTQLFSCGFFRHCAQSV 195 MKTHQ PKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKTHQQPKLKTQLFSCGFFRHCAQTV 26 >XP_014500459.1 PREDICTED: uncharacterized protein LOC106761420 [Vigna radiata var. radiata] Length = 315 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = +1 Query: 121 MKTHQ-PKLKTQLFSCGFFRHCAQSV 195 MKTHQ PKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKTHQQPKLKTQLFSCGFFRHCAQTV 26 >XP_007137194.1 hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris] ESW09188.1 hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris] Length = 315 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = +1 Query: 121 MKTHQ-PKLKTQLFSCGFFRHCAQSV 195 MKTHQ PKLKTQLFSCGFFRHCAQ+V Sbjct: 1 MKTHQQPKLKTQLFSCGFFRHCAQTV 26