BLASTX nr result
ID: Glycyrrhiza32_contig00039096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039096 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADV56692.1 NPH3 family protein [Phaseolus vulgaris] 79 3e-15 OMO63754.1 BTB/POZ-like protein [Corchorus capsularis] 79 5e-15 KRG96395.1 hypothetical protein GLYMA_19G207900 [Glycine max] 77 1e-14 XP_017413835.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 1e-14 XP_007163074.1 hypothetical protein PHAVU_001G203800g [Phaseolus... 77 1e-14 XP_007144554.1 hypothetical protein PHAVU_007G165600g [Phaseolus... 77 1e-14 KYP71495.1 BTB/POZ domain-containing protein At5g48800 family [C... 77 1e-14 KHN43539.1 BTB/POZ domain-containing protein [Glycine soja] 77 1e-14 XP_006604703.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 1e-14 XP_003518959.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 1e-14 XP_016184398.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 1e-14 XP_015951086.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 1e-14 KYP71325.1 BTB/POZ domain-containing protein At5g48800 family [C... 77 2e-14 XP_014514960.1 PREDICTED: BTB/POZ domain-containing protein At1g... 77 2e-14 KDO87367.1 hypothetical protein CISIN_1g038941mg [Citrus sinensis] 76 5e-14 KHN28223.1 BTB/POZ domain-containing protein [Glycine soja] 76 5e-14 XP_003521542.1 PREDICTED: BTB/POZ domain-containing protein At1g... 76 5e-14 XP_004495986.1 PREDICTED: BTB/POZ domain-containing protein At1g... 76 5e-14 XP_010112756.1 BTB/POZ domain-containing protein [Morus notabili... 76 5e-14 XP_006479889.1 PREDICTED: BTB/POZ domain-containing protein At1g... 76 5e-14 >ADV56692.1 NPH3 family protein [Phaseolus vulgaris] Length = 731 Score = 79.3 bits (194), Expect = 3e-15 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +1 Query: 157 GFVEKMGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 G V MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 100 GRVSLMGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 141 >OMO63754.1 BTB/POZ-like protein [Corchorus capsularis] Length = 679 Score = 78.6 bits (192), Expect = 5e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 160 FVEKMGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 F EKMGVVTV ELKPSISGKR+FRPSSSIRHATEWPISDVS Sbjct: 19 FREKMGVVTVAELKPSISGKRSFRPSSSIRHATEWPISDVS 59 >KRG96395.1 hypothetical protein GLYMA_19G207900 [Glycine max] Length = 457 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_017413835.1 PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Vigna angularis] KOM34935.1 hypothetical protein LR48_Vigan02g108500 [Vigna angularis] BAT95678.1 hypothetical protein VIGAN_08244200 [Vigna angularis var. angularis] Length = 627 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_007163074.1 hypothetical protein PHAVU_001G203800g [Phaseolus vulgaris] ESW35068.1 hypothetical protein PHAVU_001G203800g [Phaseolus vulgaris] Length = 627 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_007144554.1 hypothetical protein PHAVU_007G165600g [Phaseolus vulgaris] ESW16548.1 hypothetical protein PHAVU_007G165600g [Phaseolus vulgaris] Length = 627 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >KYP71495.1 BTB/POZ domain-containing protein At5g48800 family [Cajanus cajan] Length = 628 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >KHN43539.1 BTB/POZ domain-containing protein [Glycine soja] Length = 628 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_006604703.1 PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform X1 [Glycine max] KRG96392.1 hypothetical protein GLYMA_19G207900 [Glycine max] Length = 628 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_003518959.1 PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform X1 [Glycine max] KHN46587.1 BTB/POZ domain-containing protein [Glycine soja] KRH71541.1 hypothetical protein GLYMA_02G153500 [Glycine max] Length = 630 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_016184398.1 PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform X1 [Arachis ipaensis] Length = 634 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_015951086.1 PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform X1 [Arachis duranensis] Length = 634 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >KYP71325.1 BTB/POZ domain-containing protein At5g48800 family [Cajanus cajan] Length = 627 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPS+SGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSVSGKRTFRPSSSIRHATEWPISDVS 37 >XP_014514960.1 PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Vigna radiata var. radiata] Length = 627 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVT+GELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTIGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >KDO87367.1 hypothetical protein CISIN_1g038941mg [Citrus sinensis] Length = 615 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKR+FRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRSFRPSSSIRHATEWPISDVS 37 >KHN28223.1 BTB/POZ domain-containing protein [Glycine soja] Length = 629 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MG VTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGAVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_003521542.1 PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform X1 [Glycine max] KRH68132.1 hypothetical protein GLYMA_03G210700 [Glycine max] KRH68133.1 hypothetical protein GLYMA_03G210700 [Glycine max] Length = 629 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MG VTVGELKPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGAVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_004495986.1 PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Cicer arietinum] Length = 630 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGE KPSISGKRTFRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGEFKPSISGKRTFRPSSSIRHATEWPISDVS 37 >XP_010112756.1 BTB/POZ domain-containing protein [Morus notabilis] EXC34714.1 BTB/POZ domain-containing protein [Morus notabilis] Length = 631 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKR+FRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRSFRPSSSIRHATEWPISDVS 37 >XP_006479889.1 PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Citrus sinensis] Length = 631 Score = 75.9 bits (185), Expect = 5e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 172 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISDVS 282 MGVVTVGELKPSISGKR+FRPSSSIRHATEWPISDVS Sbjct: 1 MGVVTVGELKPSISGKRSFRPSSSIRHATEWPISDVS 37