BLASTX nr result
ID: Glycyrrhiza32_contig00039057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039057 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP32919.1 Coiled-coil domain-containing protein MTMR15 [Cajanus... 74 2e-13 XP_019452124.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 74 3e-13 XP_015962454.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 72 1e-12 XP_016194622.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 72 1e-12 XP_003621733.2 fanconi-associated nuclease-like protein [Medicag... 72 2e-12 GAU17744.1 hypothetical protein TSUD_171320 [Trifolium subterran... 71 3e-12 XP_007139299.1 hypothetical protein PHAVU_008G017600g [Phaseolus... 69 1e-11 XP_012568884.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 69 3e-11 XP_012568883.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 69 3e-11 ONI29031.1 hypothetical protein PRUPE_1G176700 [Prunus persica] 68 5e-11 XP_008244432.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 68 5e-11 KRH45240.1 hypothetical protein GLYMA_08G259800 [Glycine max] 67 9e-11 KHN15570.1 Fanconi-associated nuclease 1 like [Glycine soja] 67 9e-11 KRH01547.1 hypothetical protein GLYMA_18G283900 [Glycine max] 67 1e-10 KGN52709.1 hypothetical protein Csa_5G651670 [Cucumis sativus] 67 1e-10 KRH01546.1 hypothetical protein GLYMA_18G283900 [Glycine max] 67 1e-10 XP_011656118.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 67 1e-10 XP_018504055.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 67 1e-10 KRH01545.1 hypothetical protein GLYMA_18G283900 [Glycine max] 67 1e-10 XP_011656117.1 PREDICTED: fanconi-associated nuclease 1 homolog ... 67 1e-10 >KYP32919.1 Coiled-coil domain-containing protein MTMR15 [Cajanus cajan] Length = 895 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL Sbjct: 862 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 895 >XP_019452124.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Lupinus angustifolius] Length = 937 Score = 73.9 bits (180), Expect = 3e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGFM+EVCKVKPL Sbjct: 904 VKGPRDRLSEQQRAWLLLLMDCGFMVEVCKVKPL 937 >XP_015962454.1 PREDICTED: fanconi-associated nuclease 1 homolog [Arachis duranensis] Length = 931 Score = 72.4 bits (176), Expect = 1e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGF++EVCKVKPL Sbjct: 898 VKGPRDRLSEQQRAWLLLLMDCGFVVEVCKVKPL 931 >XP_016194622.1 PREDICTED: fanconi-associated nuclease 1 homolog [Arachis ipaensis] Length = 932 Score = 72.4 bits (176), Expect = 1e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGF++EVCKVKPL Sbjct: 899 VKGPRDRLSEQQRAWLLLLMDCGFVVEVCKVKPL 932 >XP_003621733.2 fanconi-associated nuclease-like protein [Medicago truncatula] AES77951.2 fanconi-associated nuclease-like protein [Medicago truncatula] Length = 909 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGP+DRLSEQQRAWLL+LMDCGFM+EVCKVKPL Sbjct: 876 VKGPKDRLSEQQRAWLLMLMDCGFMVEVCKVKPL 909 >GAU17744.1 hypothetical protein TSUD_171320 [Trifolium subterraneum] Length = 911 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLL+LMDCGF IEVCKVKPL Sbjct: 878 VKGPRDRLSEQQRAWLLMLMDCGFTIEVCKVKPL 911 >XP_007139299.1 hypothetical protein PHAVU_008G017600g [Phaseolus vulgaris] ESW11293.1 hypothetical protein PHAVU_008G017600g [Phaseolus vulgaris] Length = 920 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGP DRLSEQQRAWLLLLMDCGF +EVCKVKPL Sbjct: 887 VKGPSDRLSEQQRAWLLLLMDCGFAVEVCKVKPL 920 >XP_012568884.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X2 [Cicer arietinum] Length = 881 Score = 68.6 bits (166), Expect = 3e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 216 VKGP+DRLSEQQRAWLL+LMDCGF IEVCKVKP Sbjct: 848 VKGPKDRLSEQQRAWLLMLMDCGFTIEVCKVKP 880 >XP_012568883.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Cicer arietinum] Length = 916 Score = 68.6 bits (166), Expect = 3e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 216 VKGP+DRLSEQQRAWLL+LMDCGF IEVCKVKP Sbjct: 883 VKGPKDRLSEQQRAWLLMLMDCGFTIEVCKVKP 915 >ONI29031.1 hypothetical protein PRUPE_1G176700 [Prunus persica] Length = 956 Score = 67.8 bits (164), Expect = 5e-11 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGF EVCKV PL Sbjct: 922 VKGPRDRLSEQQRAWLLLLMDCGFNAEVCKVSPL 955 >XP_008244432.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Prunus mume] Length = 956 Score = 67.8 bits (164), Expect = 5e-11 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGF EVCKV PL Sbjct: 922 VKGPRDRLSEQQRAWLLLLMDCGFNAEVCKVSPL 955 >KRH45240.1 hypothetical protein GLYMA_08G259800 [Glycine max] Length = 807 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGP+DRLSEQQRAWLLLLMD GF IEVCKVKPL Sbjct: 774 VKGPKDRLSEQQRAWLLLLMDSGFTIEVCKVKPL 807 >KHN15570.1 Fanconi-associated nuclease 1 like [Glycine soja] Length = 879 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGP+DRLSEQQRAWLLLLMD GF IEVCKVKPL Sbjct: 846 VKGPKDRLSEQQRAWLLLLMDSGFTIEVCKVKPL 879 >KRH01547.1 hypothetical protein GLYMA_18G283900 [Glycine max] Length = 482 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLL+D GF IEVCKVKPL Sbjct: 449 VKGPRDRLSEQQRAWLLLLLDYGFTIEVCKVKPL 482 >KGN52709.1 hypothetical protein Csa_5G651670 [Cucumis sativus] Length = 502 Score = 66.6 bits (161), Expect = 1e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 216 VKGP+DRLSEQQRAW+LLLMDCGF+IEVCK+ P Sbjct: 469 VKGPKDRLSEQQRAWILLLMDCGFIIEVCKITP 501 >KRH01546.1 hypothetical protein GLYMA_18G283900 [Glycine max] Length = 642 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLL+D GF IEVCKVKPL Sbjct: 609 VKGPRDRLSEQQRAWLLLLLDYGFTIEVCKVKPL 642 >XP_011656118.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Cucumis sativus] Length = 755 Score = 66.6 bits (161), Expect = 1e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 216 VKGP+DRLSEQQRAW+LLLMDCGF+IEVCK+ P Sbjct: 722 VKGPKDRLSEQQRAWILLLMDCGFIIEVCKITP 754 >XP_018504055.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] XP_018507763.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] XP_018507765.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] Length = 843 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLLMDCGF EVCKV P+ Sbjct: 809 VKGPRDRLSEQQRAWLLLLMDCGFNAEVCKVNPV 842 >KRH01545.1 hypothetical protein GLYMA_18G283900 [Glycine max] Length = 899 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKPL 213 VKGPRDRLSEQQRAWLLLL+D GF IEVCKVKPL Sbjct: 866 VKGPRDRLSEQQRAWLLLLLDYGFTIEVCKVKPL 899 >XP_011656117.1 PREDICTED: fanconi-associated nuclease 1 homolog isoform X2 [Cucumis sativus] Length = 901 Score = 66.6 bits (161), Expect = 1e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 314 VKGPRDRLSEQQRAWLLLLMDCGFMIEVCKVKP 216 VKGP+DRLSEQQRAW+LLLMDCGF+IEVCK+ P Sbjct: 868 VKGPKDRLSEQQRAWILLLMDCGFIIEVCKITP 900