BLASTX nr result
ID: Glycyrrhiza32_contig00039027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00039027 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003612650.1 F-box protein interaction domain protein [Medicag... 109 5e-26 XP_003612646.2 F-box protein interaction domain protein [Medicag... 109 5e-26 XP_013450592.1 F-box protein interaction domain protein [Medicag... 98 8e-23 XP_013453550.1 F-box protein interaction domain protein [Medicag... 100 2e-22 XP_013453552.1 F-box protein interaction domain protein [Medicag... 100 2e-22 AFK40065.1 unknown [Medicago truncatula] 100 2e-22 XP_013453551.1 F-box protein interaction domain protein [Medicag... 100 2e-22 XP_003612153.1 F-box protein interaction domain protein [Medicag... 100 2e-22 XP_003612151.2 F-box protein interaction domain protein [Medicag... 100 2e-22 XP_003626550.2 F-box protein interaction domain protein [Medicag... 98 3e-22 XP_013455133.1 F-box protein interaction domain protein [Medicag... 99 3e-22 XP_013449582.1 F-box protein interaction domain protein [Medicag... 94 4e-21 XP_019454516.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 96 4e-21 XP_019454515.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 96 4e-21 XP_004512128.1 PREDICTED: F-box protein At3g07870-like [Cicer ar... 95 1e-20 XP_003625089.2 F-box protein interaction domain protein, partial... 94 1e-20 XP_003611119.2 F-box protein interaction domain protein [Medicag... 92 2e-19 XP_013453411.1 F-box protein interaction domain protein [Medicag... 89 1e-18 XP_003611117.1 F-box protein interaction domain protein [Medicag... 89 1e-18 XP_013441691.1 F-box protein interaction domain protein [Medicag... 87 4e-18 >XP_003612650.1 F-box protein interaction domain protein [Medicago truncatula] AES95608.1 F-box protein interaction domain protein [Medicago truncatula] Length = 441 Score = 109 bits (272), Expect = 5e-26 Identities = 54/92 (58%), Positives = 63/92 (68%) Frame = -3 Query: 281 PKTPIIGKTFGPICAGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTR 102 P+ I T PICA GFQPKTN+YKVIRMW+ C + + S+ + VEMHTLGT Sbjct: 174 PEAIGIANTRKPICAALGFQPKTNEYKVIRMWKRC-----DGWCYKSDVMVVEMHTLGTA 228 Query: 101 TWRNVGVNPRFFMSRLQFPTCVNGALHWINLD 6 TWRNV V+P F +RL PTCVNGALHWIN D Sbjct: 229 TWRNVEVDPMFSFTRLGSPTCVNGALHWINYD 260 >XP_003612646.2 F-box protein interaction domain protein [Medicago truncatula] AES95604.2 F-box protein interaction domain protein [Medicago truncatula] Length = 452 Score = 109 bits (272), Expect = 5e-26 Identities = 54/92 (58%), Positives = 63/92 (68%) Frame = -3 Query: 281 PKTPIIGKTFGPICAGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTR 102 P+ I T PICA GFQPKTN+YKVIRMW+ C + + S+ + VEMHTLGT Sbjct: 185 PEAIGIANTRKPICAALGFQPKTNEYKVIRMWKRC-----DGWCYKSDVMVVEMHTLGTT 239 Query: 101 TWRNVGVNPRFFMSRLQFPTCVNGALHWINLD 6 TWRNV V+P F +RL PTCVNGALHWIN D Sbjct: 240 TWRNVEVDPMFSFTRLGSPTCVNGALHWINYD 271 >XP_013450592.1 F-box protein interaction domain protein [Medicago truncatula] KEH24620.1 F-box protein interaction domain protein [Medicago truncatula] Length = 275 Score = 98.2 bits (243), Expect = 8e-23 Identities = 46/78 (58%), Positives = 56/78 (71%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR A+ W E V +E++TLGT +WRNV V+P S Sbjct: 129 AGFGFQPKTNEYKVINMW---VRHVKRANAWEFERVILEINTLGTPSWRNVEVDPHISFS 185 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 186 SLEYPTCVNGALHWIRFE 203 >XP_013453550.1 F-box protein interaction domain protein [Medicago truncatula] KEH27583.1 F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 99.8 bits (247), Expect = 2e-22 Identities = 44/78 (56%), Positives = 60/78 (76%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI +W +R +A++W+ E V +E++TLGT +WRNV V+P+ S Sbjct: 218 AGFGFQPKTNEYKVISVW---IRHVKHANQWVFERVILEINTLGTTSWRNVEVDPQISFS 274 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 275 SLKYPTCVNGALHWIRFE 292 >XP_013453552.1 F-box protein interaction domain protein [Medicago truncatula] KEH27585.1 F-box protein interaction domain protein [Medicago truncatula] Length = 473 Score = 99.8 bits (247), Expect = 2e-22 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR A+ W E +T+E++TLGT +WRNV V+P+ S Sbjct: 229 AGFGFQPKTNEYKVINMW---VRHVKRANVWEFERLTLEINTLGTPSWRNVEVDPQISFS 285 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHW+ D Sbjct: 286 SLKYPTCVNGALHWLRFD 303 >AFK40065.1 unknown [Medicago truncatula] Length = 479 Score = 99.8 bits (247), Expect = 2e-22 Identities = 44/78 (56%), Positives = 60/78 (76%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI +W +R +A++W+ E V +E++TLGT +WRNV V+P+ S Sbjct: 218 AGFGFQPKTNEYKVISVW---IRHVKHANQWVFERVILEINTLGTTSWRNVEVDPQISFS 274 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 275 SLKYPTCVNGALHWIRFE 292 >XP_013453551.1 F-box protein interaction domain protein [Medicago truncatula] KEH27584.1 F-box protein interaction domain protein [Medicago truncatula] Length = 496 Score = 99.8 bits (247), Expect = 2e-22 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR A+ W E +T+E++TLGT +WRNV V+P+ S Sbjct: 229 AGFGFQPKTNEYKVINMW---VRHVKRANVWEFERLTLEINTLGTPSWRNVEVDPQISFS 285 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHW+ D Sbjct: 286 SLKYPTCVNGALHWLRFD 303 >XP_003612153.1 F-box protein interaction domain protein [Medicago truncatula] AES95111.1 F-box protein interaction domain protein [Medicago truncatula] Length = 507 Score = 99.8 bits (247), Expect = 2e-22 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR A+ W E +T+E++TLGT +WRNV V+P+ S Sbjct: 229 AGFGFQPKTNEYKVINMW---VRHVKRANVWEFERLTLEINTLGTPSWRNVEVDPQISFS 285 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHW+ D Sbjct: 286 SLKYPTCVNGALHWLRFD 303 >XP_003612151.2 F-box protein interaction domain protein [Medicago truncatula] AES95109.2 F-box protein interaction domain protein [Medicago truncatula] Length = 512 Score = 99.8 bits (247), Expect = 2e-22 Identities = 44/78 (56%), Positives = 60/78 (76%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI +W +R +A++W+ E V +E++TLGT +WRNV V+P+ S Sbjct: 218 AGFGFQPKTNEYKVISVW---IRHVKHANQWVFERVILEINTLGTTSWRNVEVDPQISFS 274 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 275 SLKYPTCVNGALHWIRFE 292 >XP_003626550.2 F-box protein interaction domain protein [Medicago truncatula] AES82768.2 F-box protein interaction domain protein [Medicago truncatula] Length = 370 Score = 98.2 bits (243), Expect = 3e-22 Identities = 46/78 (58%), Positives = 56/78 (71%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR A+ W E V +E++TLGT +WRNV V+P S Sbjct: 129 AGFGFQPKTNEYKVINMW---VRHVKRANAWEFERVILEINTLGTPSWRNVEVDPHISFS 185 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 186 SLEYPTCVNGALHWIRFE 203 >XP_013455133.1 F-box protein interaction domain protein [Medicago truncatula] KEH29181.1 F-box protein interaction domain protein [Medicago truncatula] Length = 520 Score = 99.4 bits (246), Expect = 3e-22 Identities = 44/78 (56%), Positives = 59/78 (75%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI +W +R A++W+ E V +E++TLGT +WRNV V+P+ S Sbjct: 218 AGFGFQPKTNEYKVISVW---IRHVKQANQWVFERVILEINTLGTTSWRNVEVDPQISFS 274 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNGALHWI + Sbjct: 275 SLKYPTCVNGALHWIRFE 292 >XP_013449582.1 F-box protein interaction domain protein [Medicago truncatula] KEH23610.1 F-box protein interaction domain protein [Medicago truncatula] Length = 305 Score = 94.4 bits (233), Expect = 4e-21 Identities = 41/78 (52%), Positives = 57/78 (73%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI++W +R A+ W+ + V +E++TLG +WR V V+PR +S Sbjct: 49 AGFGFQPKTNEYKVIKIW---IRHVQRANDWVFDRVILEINTLGAPSWRTVEVDPRISIS 105 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNG LHWI + Sbjct: 106 SLKYPTCVNGVLHWIKFE 123 >XP_019454516.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X2 [Lupinus angustifolius] OIW04219.1 hypothetical protein TanjilG_00779 [Lupinus angustifolius] Length = 452 Score = 95.9 bits (237), Expect = 4e-21 Identities = 46/89 (51%), Positives = 57/89 (64%) Frame = -3 Query: 281 PKTPIIGKTFGPICAGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTR 102 PKT I P+ AGFGF KTN+YKVIRM + + +W+ + V VEMHTLGT Sbjct: 203 PKTTRIEDMRRPVYAGFGFHRKTNEYKVIRMCIKYIDISQDIRQWMFDRVVVEMHTLGTS 262 Query: 101 TWRNVGVNPRFFMSRLQFPTCVNGALHWI 15 TW+N+G F++ L FPTC NGALHWI Sbjct: 263 TWKNIGRVALAFVNELTFPTCANGALHWI 291 >XP_019454515.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X1 [Lupinus angustifolius] Length = 468 Score = 95.9 bits (237), Expect = 4e-21 Identities = 46/89 (51%), Positives = 57/89 (64%) Frame = -3 Query: 281 PKTPIIGKTFGPICAGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTR 102 PKT I P+ AGFGF KTN+YKVIRM + + +W+ + V VEMHTLGT Sbjct: 203 PKTTRIEDMRRPVYAGFGFHRKTNEYKVIRMCIKYIDISQDIRQWMFDRVVVEMHTLGTS 262 Query: 101 TWRNVGVNPRFFMSRLQFPTCVNGALHWI 15 TW+N+G F++ L FPTC NGALHWI Sbjct: 263 TWKNIGRVALAFVNELTFPTCANGALHWI 291 >XP_004512128.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_004512171.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_012574463.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_012574465.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] Length = 488 Score = 94.7 bits (234), Expect = 1e-20 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 7/86 (8%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQ-------TNAHKWISEGVTVEMHTLGTRTWRNVGV 81 AGFGF PKT +YKVI MW V+ + + W+ E +T+E+HTLGT +WRNV V Sbjct: 209 AGFGFHPKTGEYKVIHMWLKYVKGNRVMPNGVSRPYGWVFEAMTLEIHTLGTSSWRNVEV 268 Query: 80 NPRFFMSRLQFPTCVNGALHWINLDS 3 +P+F + L+ TCVNGALHWI D+ Sbjct: 269 DPQFSIKELKHATCVNGALHWIRFDN 294 >XP_003625089.2 F-box protein interaction domain protein, partial [Medicago truncatula] AES81307.2 F-box protein interaction domain protein, partial [Medicago truncatula] Length = 428 Score = 94.4 bits (233), Expect = 1e-20 Identities = 41/78 (52%), Positives = 57/78 (73%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI++W +R A+ W+ + V +E++TLG +WR V V+PR +S Sbjct: 193 AGFGFQPKTNEYKVIKIW---IRHVQRANDWVFDRVILEINTLGAPSWRTVEVDPRISIS 249 Query: 59 RLQFPTCVNGALHWINLD 6 L++PTCVNG LHWI + Sbjct: 250 SLKYPTCVNGVLHWIKFE 267 >XP_003611119.2 F-box protein interaction domain protein [Medicago truncatula] AES94077.2 F-box protein interaction domain protein [Medicago truncatula] Length = 472 Score = 91.7 bits (226), Expect = 2e-19 Identities = 44/75 (58%), Positives = 54/75 (72%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR ++ + E V +E+HTLGT +WRNV V+P+ Sbjct: 222 AGFGFQPKTNEYKVIIMWNKYVRRD---NRLVFERVVLEIHTLGTSSWRNVEVDPQISFL 278 Query: 59 RLQFPTCVNGALHWI 15 +L PTCVNGALHWI Sbjct: 279 KLLNPTCVNGALHWI 293 >XP_013453411.1 F-box protein interaction domain protein [Medicago truncatula] KEH27440.1 F-box protein interaction domain protein [Medicago truncatula] Length = 476 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/75 (57%), Positives = 53/75 (70%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR ++ + E V +E+HTLGT +WR V V+P+ Sbjct: 224 AGFGFQPKTNEYKVIIMWNKYVRRN---NRLVFERVVLEIHTLGTPSWRKVEVDPQISFL 280 Query: 59 RLQFPTCVNGALHWI 15 +L PTCVNGALHWI Sbjct: 281 KLLNPTCVNGALHWI 295 >XP_003611117.1 F-box protein interaction domain protein [Medicago truncatula] AES94075.1 F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/75 (57%), Positives = 53/75 (70%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGFQPKTN+YKVI MW VR ++ + E V +E+HTLGT +WR V V+P+ Sbjct: 238 AGFGFQPKTNEYKVIIMWNKYVRRN---NRLVFERVVLEIHTLGTPSWRKVEVDPQISFL 294 Query: 59 RLQFPTCVNGALHWI 15 +L PTCVNGALHWI Sbjct: 295 KLLNPTCVNGALHWI 309 >XP_013441691.1 F-box protein interaction domain protein [Medicago truncatula] KEH15716.1 F-box protein interaction domain protein [Medicago truncatula] Length = 419 Score = 87.4 bits (215), Expect = 4e-18 Identities = 41/78 (52%), Positives = 51/78 (65%) Frame = -3 Query: 239 AGFGFQPKTNKYKVIRMWELCVRSQTNAHKWISEGVTVEMHTLGTRTWRNVGVNPRFFMS 60 AGFGF P TN+YKVI +W V + N+ + VE+HTLGT TWRN+ V+P+ S Sbjct: 209 AGFGFYPTTNEYKVIHIWRRSV-IRVNSSSDVEHVFLVEIHTLGTSTWRNINVDPQISFS 267 Query: 59 RLQFPTCVNGALHWINLD 6 L PTCVNGALHWI + Sbjct: 268 CLMNPTCVNGALHWIRFE 285