BLASTX nr result
ID: Glycyrrhiza32_contig00038497
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00038497 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69882.1 RING-H2 finger protein ATL1E [Cajanus cajan] 114 3e-28 KHN23378.1 Putative RING-H2 finger protein ATL21A [Glycine soja] 113 5e-28 KRH53476.1 hypothetical protein GLYMA_06G127300 [Glycine max] 113 5e-28 XP_007136547.1 hypothetical protein PHAVU_009G054000g [Phaseolus... 112 9e-28 XP_014517969.1 PREDICTED: putative RING-H2 finger protein ATL21A... 111 3e-27 XP_017419758.1 PREDICTED: putative RING-H2 finger protein ATL21B... 111 4e-27 NP_001304375.1 RING-H2 finger protein ATL20 precursor [Glycine m... 111 4e-27 XP_016163352.1 PREDICTED: putative RING-H2 finger protein ATL21B... 103 4e-24 XP_015934387.1 PREDICTED: putative RING-H2 finger protein ATL21B... 103 6e-24 XP_003602221.1 RING-H2 finger ATL21B-like protein, putative [Med... 101 2e-23 XP_019435251.1 PREDICTED: putative RING-H2 finger protein ATL21A... 99 1e-22 XP_002513558.1 PREDICTED: putative RING-H2 finger protein ATL21B... 96 3e-21 XP_009378776.1 PREDICTED: putative RING-H2 finger protein ATL21B... 94 1e-20 XP_008376731.1 PREDICTED: putative RING-H2 finger protein ATL21B... 94 1e-20 XP_008234730.1 PREDICTED: putative RING-H2 finger protein ATL21B... 93 2e-20 XP_007220069.1 hypothetical protein PRUPE_ppa024723mg [Prunus pe... 93 3e-20 XP_018838703.1 PREDICTED: putative RING-H2 finger protein ATL21B... 92 3e-20 ONI25622.1 hypothetical protein PRUPE_2G312000 [Prunus persica] 93 3e-20 XP_019260537.1 PREDICTED: putative RING-H2 finger protein ATL21A... 92 4e-20 OAY48443.1 hypothetical protein MANES_06G159100 [Manihot esculenta] 92 5e-20 >KYP69882.1 RING-H2 finger protein ATL1E [Cajanus cajan] Length = 370 Score = 114 bits (284), Expect = 3e-28 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*P 172 ICLSEY PKETVK IP+CGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P Sbjct: 315 ICLSEYMPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPSKLPQPRARSSP 370 >KHN23378.1 Putative RING-H2 finger protein ATL21A [Glycine soja] Length = 385 Score = 113 bits (283), Expect = 5e-28 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 175 ICLSEY PKETVK IP+CGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPRKLPQPRARSSPQ 385 >KRH53476.1 hypothetical protein GLYMA_06G127300 [Glycine max] Length = 385 Score = 113 bits (283), Expect = 5e-28 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 175 ICLSEY PKETVK IP+CGHCFHAQCIDEWLPLNASCPICRTSP KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTSPRKLPQPRARSSPQ 385 >XP_007136547.1 hypothetical protein PHAVU_009G054000g [Phaseolus vulgaris] ESW08541.1 hypothetical protein PHAVU_009G054000g [Phaseolus vulgaris] Length = 380 Score = 112 bits (281), Expect = 9e-28 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*P 172 ICLSEY PKETVK+IP+CGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS P Sbjct: 325 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPQKFPQPRARSSP 380 >XP_014517969.1 PREDICTED: putative RING-H2 finger protein ATL21A [Vigna radiata var. radiata] Length = 378 Score = 111 bits (277), Expect = 3e-27 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS 166 ICLSEY PKETVK+IP+CGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS Sbjct: 323 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPRKFPQPRARS 376 >XP_017419758.1 PREDICTED: putative RING-H2 finger protein ATL21B [Vigna angularis] KOM41401.1 hypothetical protein LR48_Vigan04g159900 [Vigna angularis] BAT78811.1 hypothetical protein VIGAN_02154600 [Vigna angularis var. angularis] Length = 379 Score = 111 bits (277), Expect = 4e-27 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS 166 ICLSEY PKETVK+IP+CGHCFHAQCIDEWLPLNASCPICRTSP K PQP ARS Sbjct: 324 ICLSEYMPKETVKSIPECGHCFHAQCIDEWLPLNASCPICRTSPRKFPQPRARS 377 >NP_001304375.1 RING-H2 finger protein ATL20 precursor [Glycine max] ACU24071.1 unknown [Glycine max] Length = 385 Score = 111 bits (277), Expect = 4e-27 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLARS*PR 175 ICLSEY PKETVK IP+CGHCFHAQCIDEWLPLNASCPICRT P KLPQP ARS P+ Sbjct: 329 ICLSEYIPKETVKTIPECGHCFHAQCIDEWLPLNASCPICRTFPRKLPQPRARSSPQ 385 >XP_016163352.1 PREDICTED: putative RING-H2 finger protein ATL21B [Arachis ipaensis] Length = 381 Score = 103 bits (256), Expect = 4e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLP 148 PICLSEY+PKETVK IP+C HCFHAQCIDEWLPLNASCPICRTSP KLP Sbjct: 330 PICLSEYKPKETVKRIPECLHCFHAQCIDEWLPLNASCPICRTSPNKLP 378 >XP_015934387.1 PREDICTED: putative RING-H2 finger protein ATL21B [Arachis duranensis] Length = 431 Score = 103 bits (256), Expect = 6e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLP 148 PICLSEY+PKETVK IP+C HCFHAQCIDEWLPLNASCPICRTSP KLP Sbjct: 380 PICLSEYKPKETVKRIPECLHCFHAQCIDEWLPLNASCPICRTSPNKLP 428 >XP_003602221.1 RING-H2 finger ATL21B-like protein, putative [Medicago truncatula] AES72472.1 RING-H2 finger ATL21B-like protein, putative [Medicago truncatula] Length = 388 Score = 101 bits (252), Expect = 2e-23 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKL 145 PICLSEY PKETVK +P+C HCFHAQCIDEWLPLNASCPICRTSPP+L Sbjct: 332 PICLSEYMPKETVKTMPECEHCFHAQCIDEWLPLNASCPICRTSPPRL 379 >XP_019435251.1 PREDICTED: putative RING-H2 finger protein ATL21A [Lupinus angustifolius] Length = 389 Score = 99.4 bits (246), Expect = 1e-22 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPL 157 PICLS+Y PKETVK IP+C H FHA+CIDEWLPLNASCPICRTSP LPQPL Sbjct: 335 PICLSKYRPKETVKHIPECRHGFHAKCIDEWLPLNASCPICRTSPHMLPQPL 386 >XP_002513558.1 PREDICTED: putative RING-H2 finger protein ATL21B [Ricinus communis] EEF48961.1 ring finger protein, putative [Ricinus communis] Length = 377 Score = 95.5 bits (236), Expect = 3e-21 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLAR 163 ICLSEY+PKET+K IP+C HCFHA CIDEWL LNASCPICR SP +LP P A+ Sbjct: 323 ICLSEYKPKETLKTIPECQHCFHADCIDEWLKLNASCPICRKSPDRLPPPPAQ 375 >XP_009378776.1 PREDICTED: putative RING-H2 finger protein ATL21B [Pyrus x bretschneideri] Length = 366 Score = 93.6 bits (231), Expect = 1e-20 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPP 139 PICLSEY+PKET+K IPKC HCFHA CIDEWL +NA+CPICR SPP Sbjct: 321 PICLSEYQPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 366 >XP_008376731.1 PREDICTED: putative RING-H2 finger protein ATL21B [Malus domestica] Length = 366 Score = 93.6 bits (231), Expect = 1e-20 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPP 139 PICLSEY+PKET+K IPKC HCFHA CIDEWL +NA+CPICR SPP Sbjct: 321 PICLSEYQPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 366 >XP_008234730.1 PREDICTED: putative RING-H2 finger protein ATL21B [Prunus mume] Length = 368 Score = 92.8 bits (229), Expect = 2e-20 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPP 139 PICLSEY PKET+K IPKC HCFHA CIDEWL +NA+CPICR SPP Sbjct: 323 PICLSEYRPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 368 >XP_007220069.1 hypothetical protein PRUPE_ppa024723mg [Prunus persica] Length = 374 Score = 92.8 bits (229), Expect = 3e-20 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPP 139 PICLSEY PKET+K IPKC HCFHA CIDEWL +NA+CPICR SPP Sbjct: 329 PICLSEYRPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 374 >XP_018838703.1 PREDICTED: putative RING-H2 finger protein ATL21B [Juglans regia] Length = 298 Score = 91.7 bits (226), Expect = 3e-20 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPL 157 PICLSEY PKET+K IPKC HCFHA CIDEWL LNA+CPICR P PQPL Sbjct: 241 PICLSEYRPKETLKPIPKCQHCFHAACIDEWLKLNATCPICRNPP---PQPL 289 >ONI25622.1 hypothetical protein PRUPE_2G312000 [Prunus persica] Length = 398 Score = 92.8 bits (229), Expect = 3e-20 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPP 139 PICLSEY PKET+K IPKC HCFHA CIDEWL +NA+CPICR SPP Sbjct: 353 PICLSEYRPKETLKTIPKCQHCFHADCIDEWLQMNATCPICRNSPP 398 >XP_019260537.1 PREDICTED: putative RING-H2 finger protein ATL21A [Nicotiana attenuata] OIT39119.1 putative ring-h2 finger protein atl21a [Nicotiana attenuata] Length = 376 Score = 92.4 bits (228), Expect = 4e-20 Identities = 38/53 (71%), Positives = 46/53 (86%) Frame = +2 Query: 2 PICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQPLA 160 PICL+EYEPKET++ IP+C HCFHA+CIDEWL LNASCP+CR SP P+PL+ Sbjct: 321 PICLAEYEPKETLRTIPECQHCFHAECIDEWLRLNASCPVCRNSPK--PKPLS 371 >OAY48443.1 hypothetical protein MANES_06G159100 [Manihot esculenta] Length = 371 Score = 92.0 bits (227), Expect = 5e-20 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +2 Query: 5 ICLSEYEPKETVKAIPKCGHCFHAQCIDEWLPLNASCPICRTSPPKLPQP 154 ICLSEY+PKET+K IP+C HCFH CIDEWL LNASCPICR SP +LP P Sbjct: 319 ICLSEYKPKETLKTIPECQHCFHVDCIDEWLRLNASCPICRNSPLQLPPP 368