BLASTX nr result
ID: Glycyrrhiza32_contig00038298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00038298 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU44136.1 hypothetical protein TSUD_187970 [Trifolium subterran... 65 3e-12 >GAU44136.1 hypothetical protein TSUD_187970 [Trifolium subterraneum] Length = 80 Score = 65.5 bits (158), Expect = 3e-12 Identities = 30/65 (46%), Positives = 38/65 (58%) Frame = -1 Query: 204 VPARVVHSTFKDRPTHLQVLLPNQKVVT*KLIWN*GISSMCHIGHGWYKFAQDYPIQPGH 25 +PA VVH+ +P L VLLP+ LIWN SS CHIG+GWY F + I+ G Sbjct: 2 IPAHVVHTRLATKPVALPVLLPDGTAENWNLIWNTKRSSQCHIGNGWYNFVKSGSIRLGD 61 Query: 24 VVQFW 10 +QFW Sbjct: 62 KIQFW 66