BLASTX nr result
ID: Glycyrrhiza32_contig00038188
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00038188 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69249.1 putative LRR receptor-like serine/threonine-protein k... 64 2e-09 XP_016181933.1 PREDICTED: probable inactive leucine-rich repeat ... 62 9e-09 XP_014625057.1 PREDICTED: probable inactive leucine-rich repeat ... 58 3e-08 KHN43788.1 Putative inactive leucine-rich repeat receptor-like p... 58 2e-07 XP_004489659.1 PREDICTED: probable inactive leucine-rich repeat ... 57 5e-07 XP_015947065.1 PREDICTED: probable inactive leucine-rich repeat ... 56 1e-06 XP_007151761.1 hypothetical protein PHAVU_004G072600g [Phaseolus... 56 1e-06 XP_013451539.1 LRR receptor-like kinase [Medicago truncatula] KE... 55 3e-06 AFK33737.1 unknown [Lotus japonicus] 52 5e-06 >KYP69249.1 putative LRR receptor-like serine/threonine-protein kinase At1g14390 family [Cajanus cajan] Length = 621 Score = 63.9 bits (154), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWRGDSLS SSDGSPISPLASRRM F Sbjct: 586 LQFAAQVQDAWRGDSLS-SSDGSPISPLASRRMAF 619 >XP_016181933.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Arachis ipaensis] Length = 788 Score = 62.0 bits (149), Expect = 9e-09 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWR DS SQSSDGSPISPLASR M F Sbjct: 753 LQFAAQVQDAWRVDSQSQSSDGSPISPLASRPMNF 787 >XP_014625057.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770, partial [Glycine max] Length = 132 Score = 57.8 bits (138), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 368 LQFAAQVQDAWRGDS-LSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWRGDS S SSDGSPISPLASR + F Sbjct: 96 LQFAAQVQDAWRGDSQSSSSSDGSPISPLASRPLNF 131 >KHN43788.1 Putative inactive leucine-rich repeat receptor-like protein kinase [Glycine soja] Length = 280 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 368 LQFAAQVQDAWRGDS-LSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWRGDS S SSDGSPISPLASR + F Sbjct: 244 LQFAAQVQDAWRGDSQSSSSSDGSPISPLASRPLNF 279 >XP_004489659.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Cicer arietinum] XP_004489660.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Cicer arietinum] XP_012568162.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Cicer arietinum] Length = 786 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFA+QVQDAWRGD SQSSD SPISPL SRRM F Sbjct: 753 LQFASQVQDAWRGD--SQSSDSSPISPLPSRRMNF 785 >XP_015947065.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Arachis duranensis] XP_015947066.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Arachis duranensis] Length = 788 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWR DS SQSSDGS ISPLAS M F Sbjct: 753 LQFAAQVQDAWRVDSQSQSSDGSSISPLASPPMNF 787 >XP_007151761.1 hypothetical protein PHAVU_004G072600g [Phaseolus vulgaris] ESW23755.1 hypothetical protein PHAVU_004G072600g [Phaseolus vulgaris] Length = 783 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAW GDS S SDGSPISPLAS RMTF Sbjct: 749 LQFAAQVQDAWIGDSQS-GSDGSPISPLASIRMTF 782 >XP_013451539.1 LRR receptor-like kinase [Medicago truncatula] KEH25567.1 LRR receptor-like kinase [Medicago truncatula] Length = 785 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFA+QVQDAWRGDSL SSDGSPISPL RR F Sbjct: 752 LQFASQVQDAWRGDSL--SSDGSPISPLPCRRANF 784 >AFK33737.1 unknown [Lotus japonicus] Length = 148 Score = 52.4 bits (124), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 368 LQFAAQVQDAWRGDSLSQSSDGSPISPLASRRMTF 264 LQFAAQVQDAWRGD SQSS+GSP SPL R++ F Sbjct: 115 LQFAAQVQDAWRGD--SQSSEGSPSSPLEPRKLAF 147