BLASTX nr result
ID: Glycyrrhiza32_contig00037549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00037549 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019440147.1 PREDICTED: nuclear poly(A) polymerase 3-like [Lup... 70 9e-12 OIW13755.1 hypothetical protein TanjilG_17934 [Lupinus angustifo... 70 9e-12 XP_019426424.1 PREDICTED: nuclear poly(A) polymerase 3-like [Lup... 60 4e-08 OIV91787.1 hypothetical protein TanjilG_14366 [Lupinus angustifo... 60 4e-08 XP_015959507.1 PREDICTED: nuclear poly(A) polymerase 3 [Arachis ... 60 4e-08 XP_016197850.1 PREDICTED: nuclear poly(A) polymerase 3 [Arachis ... 60 4e-08 >XP_019440147.1 PREDICTED: nuclear poly(A) polymerase 3-like [Lupinus angustifolius] Length = 551 Score = 70.5 bits (171), Expect = 9e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +3 Query: 3 TCWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 TCW++IDYDKKR+QVYS QH+PHCL+ GHVAP+ EA+ LSSGG Sbjct: 511 TCWRVIDYDKKRNQVYS-QHVPHCLV-GHVAPTCEAEYLSSGG 551 >OIW13755.1 hypothetical protein TanjilG_17934 [Lupinus angustifolius] Length = 559 Score = 70.5 bits (171), Expect = 9e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +3 Query: 3 TCWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 TCW++IDYDKKR+QVYS QH+PHCL+ GHVAP+ EA+ LSSGG Sbjct: 519 TCWRVIDYDKKRNQVYS-QHVPHCLV-GHVAPTCEAEYLSSGG 559 >XP_019426424.1 PREDICTED: nuclear poly(A) polymerase 3-like [Lupinus angustifolius] XP_019426425.1 PREDICTED: nuclear poly(A) polymerase 3-like [Lupinus angustifolius] Length = 544 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 3 TCWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 TC K+ D+D KRS VYS QHLPHCL+ G V PS +A+CLSSGG Sbjct: 504 TCRKLTDHDNKRSPVYS-QHLPHCLV-GQVTPSGDAECLSSGG 544 >OIV91787.1 hypothetical protein TanjilG_14366 [Lupinus angustifolius] Length = 562 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 3 TCWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 TC K+ D+D KRS VYS QHLPHCL+ G V PS +A+CLSSGG Sbjct: 522 TCRKLTDHDNKRSPVYS-QHLPHCLV-GQVTPSGDAECLSSGG 562 >XP_015959507.1 PREDICTED: nuclear poly(A) polymerase 3 [Arachis duranensis] Length = 567 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 6 CWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 CWK++ DKKRSQVY Q H+ HCL+ GHV+ + E +CLSS G Sbjct: 527 CWKMVGCDKKRSQVYPQHHIQHCLV-GHVSSNGEGECLSSSG 567 >XP_016197850.1 PREDICTED: nuclear poly(A) polymerase 3 [Arachis ipaensis] Length = 571 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 6 CWKIIDYDKKRSQVYSQQHLPHCLIGGHVAPSSEAKCLSSGG 131 CWK++ DKKRSQVY Q H+ HCL+ GHV+ + E +CLSS G Sbjct: 531 CWKMVGCDKKRSQVYPQHHIQHCLV-GHVSSNGEGECLSSSG 571