BLASTX nr result
ID: Glycyrrhiza32_contig00037503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00037503 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013452265.1 FAR1 DNA-binding domain protein [Medicago truncat... 79 2e-14 GAU43932.1 hypothetical protein TSUD_135800 [Trifolium subterran... 76 2e-13 ABN05764.1 hypothetical protein MtrDRAFT_AC148775g42v2 [Medicago... 65 4e-11 XP_003595182.1 FAR1 DNA-binding domain protein [Medicago truncat... 55 4e-06 >XP_013452265.1 FAR1 DNA-binding domain protein [Medicago truncatula] KEH26293.1 FAR1 DNA-binding domain protein [Medicago truncatula] Length = 340 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 142 METSECQPIENDDPKEIFLGQVVNSKDEAYNLYLDHAFKMGFSVRKG 2 ME SECQ +E D P++IFLGQVV SKDEAYNLY +H FKMGFSVRKG Sbjct: 1 MEGSECQAVEIDKPRDIFLGQVVQSKDEAYNLYQEHGFKMGFSVRKG 47 >GAU43932.1 hypothetical protein TSUD_135800 [Trifolium subterraneum] Length = 605 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/47 (70%), Positives = 43/47 (91%) Frame = -1 Query: 142 METSECQPIENDDPKEIFLGQVVNSKDEAYNLYLDHAFKMGFSVRKG 2 ME +EC+ IE D+PK+I+LGQVV+SK+EAY+LY +HAFK+GFSVRKG Sbjct: 1 MEINECESIETDEPKDIYLGQVVHSKEEAYDLYQEHAFKVGFSVRKG 47 >ABN05764.1 hypothetical protein MtrDRAFT_AC148775g42v2 [Medicago truncatula] Length = 68 Score = 64.7 bits (156), Expect = 4e-11 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 139 ETSECQPIENDDPKEIFLGQVVNSKDEAYNLYLDHAFKMGFSVRKG 2 + +E QP+E D +EIFLGQVVN+KDEAYNLY +AF+ GFSV KG Sbjct: 19 DINESQPVEIDGSEEIFLGQVVNNKDEAYNLYQKYAFRKGFSVGKG 64 >XP_003595182.1 FAR1 DNA-binding domain protein [Medicago truncatula] AES65433.1 FAR1 DNA-binding domain protein [Medicago truncatula] Length = 296 Score = 55.1 bits (131), Expect = 4e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 132 VNANQLKMMTPKKFFLVKW*IAKMKLITYTWIMPSKWVLV*ERG 1 +N N+LK+M KKFFLVK I KMKLITYT MPS+ VLV ERG Sbjct: 54 MNLNRLKLMGQKKFFLVKLSITKMKLITYTKNMPSERVLVWERG 97