BLASTX nr result
ID: Glycyrrhiza32_contig00036974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00036974 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75722.1 Two-component response regulator ARR11 [Cajanus cajan] 103 3e-24 KRG97483.1 hypothetical protein GLYMA_18G010800 [Glycine max] 102 4e-24 XP_014626435.1 PREDICTED: LOW QUALITY PROTEIN: two-component res... 102 6e-24 KHN24104.1 Two-component response regulator ARR11 [Glycine soja] 102 6e-24 KRH31408.1 hypothetical protein GLYMA_11G246400 [Glycine max] 100 2e-23 KRH31407.1 hypothetical protein GLYMA_11G246400 [Glycine max] 100 2e-23 KHN44399.1 Two-component response regulator ARR11 [Glycine soja] 100 3e-23 XP_003537547.1 PREDICTED: two-component response regulator ARR11... 100 3e-23 XP_006591475.1 PREDICTED: two-component response regulator ARR11... 100 3e-23 XP_017418952.1 PREDICTED: two-component response regulator ORR26... 98 3e-22 XP_017418950.1 PREDICTED: two-component response regulator ARR11... 98 3e-22 XP_014520244.1 PREDICTED: two-component response regulator ORR26... 94 1e-20 XP_014520235.1 PREDICTED: two-component response regulator ARR11... 94 1e-20 XP_012571838.1 PREDICTED: two-component response regulator ARR11... 86 5e-18 XP_004502338.1 PREDICTED: two-component response regulator ARR11... 86 5e-18 XP_013461243.1 two-component response regulator ARR2-like protei... 83 6e-17 XP_003601849.1 two-component response regulator ARR2-like protei... 83 7e-17 AFK40300.1 unknown [Medicago truncatula] 83 7e-17 KYP52982.1 Two-component response regulator ARR11 [Cajanus cajan] 79 2e-15 XP_006580109.1 PREDICTED: two-component response regulator ORR26... 78 3e-15 >KYP75722.1 Two-component response regulator ARR11 [Cajanus cajan] Length = 544 Score = 103 bits (257), Expect = 3e-24 Identities = 50/70 (71%), Positives = 57/70 (81%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 AEK RALTGN I DT + E R+ LNQPFVPL+SEGN SVFDC+M TQYSWTEVP + L Sbjct: 332 AEKGRALTGN--IADTNMREGFRVSLNQPFVPLESEGNRSVFDCSMPTQYSWTEVPHLQL 389 Query: 183 KEEHKSLVHL 212 KE+HKSLV+L Sbjct: 390 KEDHKSLVNL 399 >KRG97483.1 hypothetical protein GLYMA_18G010800 [Glycine max] Length = 455 Score = 102 bits (255), Expect = 4e-24 Identities = 50/71 (70%), Positives = 58/71 (81%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SEGNH+VFDC+M T YSWTEVP + L Sbjct: 329 AKKGRILTGN--IADTNMRESLRVGLNQTFPPLESEGNHAVFDCSMPTPYSWTEVPHMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLV+LE Sbjct: 387 KEEHKSLVYLE 397 >XP_014626435.1 PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR11-like [Glycine max] Length = 579 Score = 102 bits (255), Expect = 6e-24 Identities = 50/71 (70%), Positives = 58/71 (81%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SEGNH+VFDC+M T YSWTEVP + L Sbjct: 329 AKKGRILTGN--IADTNMRESLRVGLNQTFPPLESEGNHAVFDCSMPTPYSWTEVPHMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLV+LE Sbjct: 387 KEEHKSLVYLE 397 >KHN24104.1 Two-component response regulator ARR11 [Glycine soja] Length = 579 Score = 102 bits (255), Expect = 6e-24 Identities = 50/71 (70%), Positives = 58/71 (81%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SEGNH+VFDC+M T YSWTEVP + L Sbjct: 329 AKKGRILTGN--IADTNMRESLRVGLNQTFPPLESEGNHAVFDCSMPTPYSWTEVPHMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLV+LE Sbjct: 387 KEEHKSLVYLE 397 >KRH31408.1 hypothetical protein GLYMA_11G246400 [Glycine max] Length = 514 Score = 100 bits (250), Expect = 2e-23 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SE NH+VFDC+M T Y+WTEVP + L Sbjct: 262 AKKGRILTGN--IADTNMRESLRVGLNQTFAPLESEENHAVFDCSMPTPYTWTEVPHMQL 319 Query: 183 KEEHKSLVHLE 215 KEEHKS+VHLE Sbjct: 320 KEEHKSIVHLE 330 >KRH31407.1 hypothetical protein GLYMA_11G246400 [Glycine max] Length = 533 Score = 100 bits (250), Expect = 2e-23 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SE NH+VFDC+M T Y+WTEVP + L Sbjct: 281 AKKGRILTGN--IADTNMRESLRVGLNQTFAPLESEENHAVFDCSMPTPYTWTEVPHMQL 338 Query: 183 KEEHKSLVHLE 215 KEEHKS+VHLE Sbjct: 339 KEEHKSIVHLE 349 >KHN44399.1 Two-component response regulator ARR11 [Glycine soja] Length = 585 Score = 100 bits (250), Expect = 3e-23 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SE NH+VFDC+M T Y+WTEVP + L Sbjct: 333 AKKGRILTGN--IADTNMRESLRVGLNQTFAPLESEENHAVFDCSMPTPYTWTEVPHMQL 390 Query: 183 KEEHKSLVHLE 215 KEEHKS+VHLE Sbjct: 391 KEEHKSIVHLE 401 >XP_003537547.1 PREDICTED: two-component response regulator ARR11 isoform X2 [Glycine max] KRH31405.1 hypothetical protein GLYMA_11G246400 [Glycine max] KRH31406.1 hypothetical protein GLYMA_11G246400 [Glycine max] Length = 585 Score = 100 bits (250), Expect = 3e-23 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SE NH+VFDC+M T Y+WTEVP + L Sbjct: 333 AKKGRILTGN--IADTNMRESLRVGLNQTFAPLESEENHAVFDCSMPTPYTWTEVPHMQL 390 Query: 183 KEEHKSLVHLE 215 KEEHKS+VHLE Sbjct: 391 KEEHKSIVHLE 401 >XP_006591475.1 PREDICTED: two-component response regulator ARR11 isoform X1 [Glycine max] KRH31403.1 hypothetical protein GLYMA_11G246400 [Glycine max] KRH31404.1 hypothetical protein GLYMA_11G246400 [Glycine max] Length = 604 Score = 100 bits (250), Expect = 3e-23 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN I DT + ESLR+GLNQ F PL+SE NH+VFDC+M T Y+WTEVP + L Sbjct: 352 AKKGRILTGN--IADTNMRESLRVGLNQTFAPLESEENHAVFDCSMPTPYTWTEVPHMQL 409 Query: 183 KEEHKSLVHLE 215 KEEHKS+VHLE Sbjct: 410 KEEHKSIVHLE 420 >XP_017418952.1 PREDICTED: two-component response regulator ORR26-like isoform X2 [Vigna angularis] Length = 526 Score = 97.8 bits (242), Expect = 3e-22 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN +TD+ + ES R+GLNQPF SEGNH+VFDC++ TQYSWTEVP + L Sbjct: 331 AKKGRPLTGN--VTDSNMRESSRVGLNQPFA--QSEGNHAVFDCSLPTQYSWTEVPNMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLVHLE Sbjct: 387 KEEHKSLVHLE 397 >XP_017418950.1 PREDICTED: two-component response regulator ARR11-like isoform X1 [Vigna angularis] XP_017418951.1 PREDICTED: two-component response regulator ARR11-like isoform X1 [Vigna angularis] KOM39741.1 hypothetical protein LR48_Vigan03g312300 [Vigna angularis] BAT86579.1 hypothetical protein VIGAN_04424900 [Vigna angularis var. angularis] Length = 578 Score = 97.8 bits (242), Expect = 3e-22 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN +TD+ + ES R+GLNQPF SEGNH+VFDC++ TQYSWTEVP + L Sbjct: 331 AKKGRPLTGN--VTDSNMRESSRVGLNQPFA--QSEGNHAVFDCSLPTQYSWTEVPNMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLVHLE Sbjct: 387 KEEHKSLVHLE 397 >XP_014520244.1 PREDICTED: two-component response regulator ORR26-like isoform X2 [Vigna radiata var. radiata] Length = 526 Score = 93.6 bits (231), Expect = 1e-20 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN + D+ + ES R+GLNQPF SEGNH+VFDC++ TQYSWTEVP + L Sbjct: 331 AKKGRPLTGN--VADSNIRESSRVGLNQPFA--QSEGNHAVFDCSLPTQYSWTEVPHMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLV LE Sbjct: 387 KEEHKSLVQLE 397 >XP_014520235.1 PREDICTED: two-component response regulator ARR11-like isoform X1 [Vigna radiata var. radiata] Length = 578 Score = 93.6 bits (231), Expect = 1e-20 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 A+K R LTGN + D+ + ES R+GLNQPF SEGNH+VFDC++ TQYSWTEVP + L Sbjct: 331 AKKGRPLTGN--VADSNIRESSRVGLNQPFA--QSEGNHAVFDCSLPTQYSWTEVPHMQL 386 Query: 183 KEEHKSLVHLE 215 KEEHKSLV LE Sbjct: 387 KEEHKSLVQLE 397 >XP_012571838.1 PREDICTED: two-component response regulator ARR11 isoform X2 [Cicer arietinum] Length = 569 Score = 85.9 bits (211), Expect = 5e-18 Identities = 44/71 (61%), Positives = 52/71 (73%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 AEK RA+TGN ITD +T N+PF PLDSEG +V DCT+STQYSWTE+P+ L Sbjct: 332 AEKVRAITGN--ITDAGITH------NRPFAPLDSEGKCAVIDCTLSTQYSWTEIPKRQL 383 Query: 183 KEEHKSLVHLE 215 KEE +SLVHLE Sbjct: 384 KEEQESLVHLE 394 >XP_004502338.1 PREDICTED: two-component response regulator ARR11 isoform X1 [Cicer arietinum] Length = 590 Score = 85.9 bits (211), Expect = 5e-18 Identities = 44/71 (61%), Positives = 52/71 (73%) Frame = +3 Query: 3 AEKARALTGNTNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIPL 182 AEK RA+TGN ITD +T N+PF PLDSEG +V DCT+STQYSWTE+P+ L Sbjct: 353 AEKVRAITGN--ITDAGITH------NRPFAPLDSEGKCAVIDCTLSTQYSWTEIPKRQL 404 Query: 183 KEEHKSLVHLE 215 KEE +SLVHLE Sbjct: 405 KEEQESLVHLE 415 >XP_013461243.1 two-component response regulator ARR2-like protein [Medicago truncatula] KEH35278.1 two-component response regulator ARR2-like protein [Medicago truncatula] Length = 499 Score = 82.8 bits (203), Expect = 6e-17 Identities = 43/72 (59%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = +3 Query: 3 AEKARALTGN-TNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIP 179 AEKARALTGN T+ TDT LN+PF PL+SE FDC MST YSWTE+P+ Sbjct: 261 AEKARALTGNITDATDT--------ALNKPFAPLESERKRGAFDCNMSTPYSWTEIPKTQ 312 Query: 180 LKEEHKSLVHLE 215 LK+E KS+VHLE Sbjct: 313 LKKEQKSVVHLE 324 >XP_003601849.1 two-component response regulator ARR2-like protein [Medicago truncatula] AES72100.1 two-component response regulator ARR2-like protein [Medicago truncatula] Length = 570 Score = 82.8 bits (203), Expect = 7e-17 Identities = 43/72 (59%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = +3 Query: 3 AEKARALTGN-TNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIP 179 AEKARALTGN T+ TDT LN+PF PL+SE FDC MST YSWTE+P+ Sbjct: 332 AEKARALTGNITDATDT--------ALNKPFAPLESERKRGAFDCNMSTPYSWTEIPKTQ 383 Query: 180 LKEEHKSLVHLE 215 LK+E KS+VHLE Sbjct: 384 LKKEQKSVVHLE 395 >AFK40300.1 unknown [Medicago truncatula] Length = 570 Score = 82.8 bits (203), Expect = 7e-17 Identities = 43/72 (59%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = +3 Query: 3 AEKARALTGN-TNITDTKVTESLRMGLNQPFVPLDSEGNHSVFDCTMSTQYSWTEVPEIP 179 AEKARALTGN T+ TDT LN+PF PL+SE FDC MST YSWTE+P+ Sbjct: 332 AEKARALTGNITDATDT--------ALNKPFAPLESERKRGAFDCNMSTPYSWTEIPKTQ 383 Query: 180 LKEEHKSLVHLE 215 LK+E KS+VHLE Sbjct: 384 LKKEQKSVVHLE 395 >KYP52982.1 Two-component response regulator ARR11 [Cajanus cajan] Length = 579 Score = 78.6 bits (192), Expect = 2e-15 Identities = 39/71 (54%), Positives = 53/71 (74%), Gaps = 1/71 (1%) Frame = +3 Query: 6 EKARALTGNTNITDTKVTESLRMGLNQPFVPLDS-EGNHSVFDCTMSTQYSWTEVPEIPL 182 EK RA T ++I D K+ ++ +M LNQPF P++S E NH+VFDCT+ TQYSW+E P+ L Sbjct: 331 EKRRAST--SDIPDPKIQKASQMSLNQPFAPVESSEANHAVFDCTLPTQYSWSEFPKGAL 388 Query: 183 KEEHKSLVHLE 215 KEE K+LV +E Sbjct: 389 KEEQKTLVQIE 399 >XP_006580109.1 PREDICTED: two-component response regulator ORR26-like isoform X3 [Glycine max] Length = 512 Score = 78.2 bits (191), Expect = 3e-15 Identities = 40/71 (56%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = +3 Query: 6 EKARALTGNTNITDTKVTESLRMGLNQPFVPLDS-EGNHSVFDCTMSTQYSWTEVPEIPL 182 EK R TG+ I D K+ +S + LNQPF ++S E NH+VFDCT+ TQYSW+E P+ PL Sbjct: 262 EKRRGSTGD--IPDPKIQKSSQKSLNQPFTSVESSEANHAVFDCTIPTQYSWSEFPKGPL 319 Query: 183 KEEHKSLVHLE 215 KEE K+LV LE Sbjct: 320 KEEQKTLVQLE 330