BLASTX nr result
ID: Glycyrrhiza32_contig00036714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00036714 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004503108.1 PREDICTED: importin-5-like [Cicer arietinum] 60 2e-08 GAU22441.1 hypothetical protein TSUD_123280 [Trifolium subterran... 60 3e-08 XP_019434792.1 PREDICTED: importin-5-like [Lupinus angustifolius] 60 4e-08 OIV89355.1 hypothetical protein TanjilG_22690 [Lupinus angustifo... 60 4e-08 XP_003600671.1 importin beta-3, putative [Medicago truncatula] A... 57 4e-07 XP_016192905.1 PREDICTED: uncharacterized protein LOC107633820 [... 56 6e-07 XP_016186493.1 PREDICTED: uncharacterized protein LOC107628241 [... 56 6e-07 XP_015956605.1 PREDICTED: importin-5-like [Arachis duranensis] 56 6e-07 KYP76005.1 Importin-5 [Cajanus cajan] 54 3e-06 >XP_004503108.1 PREDICTED: importin-5-like [Cicer arietinum] Length = 751 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILSEL L +DPN+S+ +NAK DVAVSAL RICEFHRD ID Sbjct: 599 ILSELGNLMKDPNRSISENAKACDVAVSALGRICEFHRDTID 640 >GAU22441.1 hypothetical protein TSUD_123280 [Trifolium subterraneum] Length = 306 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILSELS L +DP++S+ +NAK DVAVSA+ RICEFHRD ID Sbjct: 154 ILSELSNLMKDPSRSISENAKACDVAVSAVGRICEFHRDSID 195 >XP_019434792.1 PREDICTED: importin-5-like [Lupinus angustifolius] Length = 748 Score = 59.7 bits (143), Expect = 4e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILSELSIL + PN +NAKEYD+AVSAL RICEFHRD ID Sbjct: 600 ILSELSILIQAPNA---RNAKEYDIAVSALGRICEFHRDSID 638 >OIV89355.1 hypothetical protein TanjilG_22690 [Lupinus angustifolius] Length = 859 Score = 59.7 bits (143), Expect = 4e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILSELSIL + PN +NAKEYD+AVSAL RICEFHRD ID Sbjct: 600 ILSELSILIQAPNA---RNAKEYDIAVSALGRICEFHRDSID 638 >XP_003600671.1 importin beta-3, putative [Medicago truncatula] AES70922.1 importin beta-3, putative [Medicago truncatula] Length = 762 Score = 56.6 bits (135), Expect = 4e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILSEL+IL +DPN+S +NAK D+AVSA+ RICEFHRD ID Sbjct: 612 ILSELNILIKDPNRS--ENAKACDIAVSAIGRICEFHRDCID 651 >XP_016192905.1 PREDICTED: uncharacterized protein LOC107633820 [Arachis ipaensis] Length = 741 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 100 ILSELS-ILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILS LS +L ++PN S+ +NAK YD+AVS L RICEFHRD ID Sbjct: 589 ILSYLSSVLIKEPNHSISENAKVYDIAVSVLGRICEFHRDTID 631 >XP_016186493.1 PREDICTED: uncharacterized protein LOC107628241 [Arachis ipaensis] Length = 741 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 100 ILSELS-ILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILS LS +L ++PN S+ +NAK YD+AVS L RICEFHRD ID Sbjct: 589 ILSYLSSVLIKEPNHSISENAKVYDIAVSVLGRICEFHRDTID 631 >XP_015956605.1 PREDICTED: importin-5-like [Arachis duranensis] Length = 741 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 100 ILSELS-ILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 ILS LS +L ++PN S+ +NAK YD+AVS L RICEFHRD ID Sbjct: 589 ILSYLSSVLIKEPNHSISENAKVYDIAVSVLGRICEFHRDTID 631 >KYP76005.1 Importin-5 [Cajanus cajan] Length = 712 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 100 ILSELSILTRDPNQSLPKNAKEYDVAVSALRRICEFHRDGID 225 IL EL +L PN+SL +NAK +D+AVSAL RICE HR+ ID Sbjct: 570 ILLELGVLMNHPNRSLSENAKAHDIAVSALGRICEVHRECID 611