BLASTX nr result
ID: Glycyrrhiza32_contig00036568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00036568 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_073470630.1 hypothetical protein [Enterococcus faecium] 52 1e-06 WP_073990047.1 hypothetical protein [Enterococcus faecium] 52 2e-06 WP_073491048.1 hypothetical protein [Enterococcus faecium] 52 2e-06 WP_073421133.1 hypothetical protein [Enterococcus faecium] 50 4e-06 WP_073459402.1 hypothetical protein [Enterococcus faecalis] 50 4e-06 WP_073990122.1 hypothetical protein [Enterococcus faecium] 50 5e-06 WP_073985109.1 hypothetical protein [Enterococcus faecium] 50 5e-06 WP_073459383.1 hypothetical protein [Enterococcus faecalis] 50 6e-06 WP_073495677.1 hypothetical protein [Enterococcus faecalis] 50 7e-06 WP_073459378.1 hypothetical protein [Enterococcus faecalis] 50 7e-06 WP_073470585.1 hypothetical protein [Enterococcus faecium] 50 8e-06 WP_073506661.1 hypothetical protein [Enterococcus faecium] 50 8e-06 WP_073506680.1 hypothetical protein [Enterococcus faecium] 49 8e-06 WP_073491038.1 hypothetical protein [Enterococcus faecium] 49 9e-06 WP_073421200.1 hypothetical protein [Enterococcus faecium] 50 9e-06 WP_073994929.1 hypothetical protein [Enterococcus faecium] 50 1e-05 WP_073491071.1 hypothetical protein [Enterococcus faecium] 49 1e-05 WP_073421116.1 hypothetical protein [Enterococcus faecium] 49 1e-05 WP_073495509.1 hypothetical protein [Enterococcus faecalis] 50 1e-05 >WP_073470630.1 hypothetical protein [Enterococcus faecium] Length = 79 Score = 52.0 bits (123), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSP 255 FFLMIRRPPRSTLFPYTTLFRSP Sbjct: 11 FFLMIRRPPRSTLFPYTTLFRSP 33 >WP_073990047.1 hypothetical protein [Enterococcus faecium] Length = 93 Score = 52.0 bits (123), Expect = 2e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 321 FFNDTATTEIYTLSLHDALPISNCSGVVGNCCFPTR 214 FFNDTATTEIYTLSLHDALPI + G G P R Sbjct: 16 FFNDTATTEIYTLSLHDALPIFSLGGPTGYAINPAR 51 >WP_073491048.1 hypothetical protein [Enterococcus faecium] Length = 84 Score = 51.6 bits (122), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 321 FFNDTATTEIYTLSLHDALPISNCSGVVGNCCF 223 FFNDTATTEIYTLSLHDALPISN + C F Sbjct: 18 FFNDTATTEIYTLSLHDALPISNHDHPLTCCLF 50 >WP_073421133.1 hypothetical protein [Enterococcus faecium] Length = 73 Score = 50.4 bits (119), Expect = 4e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPIAQG 243 FFLMIRRPPRSTLFPYTTLFRS +G Sbjct: 7 FFLMIRRPPRSTLFPYTTLFRSQEKEG 33 >WP_073459402.1 hypothetical protein [Enterococcus faecalis] Length = 75 Score = 50.4 bits (119), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 321 FFNDTATTEIYTLSLHDALPISN 253 FFNDTATTEIYTLSLHDALPISN Sbjct: 15 FFNDTATTEIYTLSLHDALPISN 37 >WP_073990122.1 hypothetical protein [Enterococcus faecium] Length = 85 Score = 50.4 bits (119), Expect = 5e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPIAQGL 240 FFLMIRRPPRSTLFPYTTLFRS A+ L Sbjct: 15 FFLMIRRPPRSTLFPYTTLFRSRQAETL 42 >WP_073985109.1 hypothetical protein [Enterococcus faecium] Length = 71 Score = 50.1 bits (118), Expect = 5e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +3 Query: 240 QPLSNWRSEERRVGKECRSRWSPYH 314 +PL RSEERRVGKECRSRWSPYH Sbjct: 47 KPLETSRSEERRVGKECRSRWSPYH 71 >WP_073459383.1 hypothetical protein [Enterococcus faecalis] Length = 74 Score = 50.1 bits (118), Expect = 6e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPIAQ 246 FFLMIRRPPRSTLFPYTTLFRS + + Sbjct: 14 FFLMIRRPPRSTLFPYTTLFRSRVEE 39 >WP_073495677.1 hypothetical protein [Enterococcus faecalis] Length = 95 Score = 50.4 bits (119), Expect = 7e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPIAQGL 240 FFLMIRR PRSTLFPYTTLFRS A+GL Sbjct: 12 FFLMIRRTPRSTLFPYTTLFRSLAAKGL 39 >WP_073459378.1 hypothetical protein [Enterococcus faecalis] Length = 65 Score = 49.7 bits (117), Expect = 7e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS + Sbjct: 34 FFLMIRRPPRSTLFPYTTLFRSSL 57 >WP_073470585.1 hypothetical protein [Enterococcus faecium] Length = 71 Score = 49.7 bits (117), Expect = 8e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS + Sbjct: 10 FFLMIRRPPRSTLFPYTTLFRSSL 33 >WP_073506661.1 hypothetical protein [Enterococcus faecium] Length = 73 Score = 49.7 bits (117), Expect = 8e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS + Sbjct: 33 FFLMIRRPPRSTLFPYTTLFRSVV 56 >WP_073506680.1 hypothetical protein [Enterococcus faecium] Length = 60 Score = 49.3 bits (116), Expect = 8e-06 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -1 Query: 314 MIRRPPRSTLFPYTTLFRSPIAQGL*ATAVSQLGL*SVFVFHLSNLA 174 MIRRPPRSTLFPYTTLFRS + A + +G+ + HL LA Sbjct: 1 MIRRPPRSTLFPYTTLFRSAFEELYEAGKIKAIGVSNFLPHHLDTLA 47 >WP_073491038.1 hypothetical protein [Enterococcus faecium] Length = 62 Score = 49.3 bits (116), Expect = 9e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 240 QPLSNWRSEERRVGKECRSRWSPYH 314 Q LS RSEERRVGKECRSRWSPYH Sbjct: 38 QKLSAARSEERRVGKECRSRWSPYH 62 >WP_073421200.1 hypothetical protein [Enterococcus faecium] Length = 113 Score = 50.4 bits (119), Expect = 9e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS I Sbjct: 19 FFLMIRRPPRSTLFPYTTLFRSSI 42 >WP_073994929.1 hypothetical protein [Enterococcus faecium] Length = 82 Score = 49.7 bits (117), Expect = 1e-05 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS + Sbjct: 16 FFLMIRRPPRSTLFPYTTLFRSTL 39 >WP_073491071.1 hypothetical protein [Enterococcus faecium] Length = 67 Score = 49.3 bits (116), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRS 258 FFLMIRRPPRSTLFPYTTLFRS Sbjct: 15 FFLMIRRPPRSTLFPYTTLFRS 36 >WP_073421116.1 hypothetical protein [Enterococcus faecium] Length = 68 Score = 49.3 bits (116), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRS 258 FFLMIRRPPRSTLFPYTTLFRS Sbjct: 15 FFLMIRRPPRSTLFPYTTLFRS 36 >WP_073495509.1 hypothetical protein [Enterococcus faecalis] Length = 99 Score = 50.1 bits (118), Expect = 1e-05 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 323 FFLMIRRPPRSTLFPYTTLFRSPI 252 FFLMIRRPPRSTLFPYTTLFRS + Sbjct: 19 FFLMIRRPPRSTLFPYTTLFRSSV 42