BLASTX nr result
ID: Glycyrrhiza32_contig00035956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035956 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 9e-36 XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 1e-34 XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 3e-32 XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 4e-32 XP_015880282.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 3e-31 XP_015880277.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 3e-31 XP_010274732.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 2e-30 CAN82481.1 hypothetical protein VITISV_012747 [Vitis vinifera] 122 2e-30 XP_003633738.2 PREDICTED: pentatricopeptide repeat-containing pr... 121 4e-30 XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 4e-30 EEF31203.1 pentatricopeptide repeat-containing protein, putative... 121 5e-30 XP_006430611.1 hypothetical protein CICLE_v10011485mg [Citrus cl... 120 6e-30 GAV76712.1 PPR domain-containing protein/PPR_2 domain-containing... 120 9e-30 XP_013466859.1 PPR containing plant protein [Medicago truncatula... 120 1e-29 XP_006482125.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 3e-29 XP_002305195.1 pentatricopeptide repeat-containing family protei... 119 3e-29 XP_011002790.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 4e-29 XP_018844095.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 5e-29 XP_010036957.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 6e-29 XP_010940143.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 6e-29 >XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570098.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012567888.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] Length = 551 Score = 136 bits (343), Expect = 9e-36 Identities = 64/99 (64%), Positives = 81/99 (81%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 +C+SFR +NWD ++ +F S++L+ SLVEQVLLELK P DAK AL FFHWS+KTH F+HG Sbjct: 41 LCNSFRMKQNWDTLTHKFSSIKLNHSLVEQVLLELKHPTDAKNALSFFHWSSKTHSFQHG 100 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKNTDSPAVRA 301 +RSY I IH+LL+AGL+TDA ALLESL NK+T + VRA Sbjct: 101 LRSYSITIHLLLQAGLITDANALLESLVNKHTKTHTVRA 139 >XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175628.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175629.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175631.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175633.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175634.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] Length = 547 Score = 133 bits (335), Expect = 1e-34 Identities = 62/95 (65%), Positives = 76/95 (80%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AIC+SFRRG NWD +S +FG+ L+D +VE+VLLELKDP DAK ALGFFHWS K +H Sbjct: 46 AICNSFRRGWNWDTISIKFGTFMLNDWMVERVLLELKDPSDAKCALGFFHWSTKRRNIEH 105 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 G+R YCIAIH+L+RA L+ DA+ALLESL NK +S Sbjct: 106 GIRCYCIAIHILVRARLLNDARALLESLLNKTKES 140 >XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Lupinus angustifolius] OIV90410.1 hypothetical protein TanjilG_00054 [Lupinus angustifolius] Length = 535 Score = 127 bits (318), Expect = 3e-32 Identities = 59/95 (62%), Positives = 75/95 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 A+C+SFR+G NWD ++ +FGS +LSDS+VEQVLLE ++P DAK AL FFHWS K FKH Sbjct: 35 AVCNSFRKGWNWDIITNKFGSFKLSDSVVEQVLLEFRNPSDAKNALSFFHWSTKNMGFKH 94 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 G SYC IH+L+RA LVTDA+AL+ES+ KN +S Sbjct: 95 GTWSYCAVIHILVRARLVTDARALVESVLLKNKES 129 >XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939465.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939466.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939467.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939468.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939469.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939470.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939472.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939473.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] Length = 547 Score = 126 bits (317), Expect = 4e-32 Identities = 60/95 (63%), Positives = 73/95 (76%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AIC+SFRRG NWD +S +FG+ L+ +VE+VLLELKDP DAK ALGFFHWS K +H Sbjct: 46 AICNSFRRGWNWDTISIKFGTFMLNHLMVERVLLELKDPSDAKCALGFFHWSTKRRNIEH 105 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 G+R YCIAIH+L+ A L+ DA ALLESL NK +S Sbjct: 106 GIRCYCIAIHILVGARLLNDACALLESLLNKTKES 140 >XP_015880282.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Ziziphus jujuba] Length = 551 Score = 124 bits (311), Expect = 3e-31 Identities = 59/95 (62%), Positives = 77/95 (81%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AIC S R GRNWD +S +FGSV+L + +V++VLLELK+P+DAK ALGFFHWSA + +H Sbjct: 38 AICCSLRAGRNWDILSRKFGSVDLDEVVVKKVLLELKEPVDAKRALGFFHWSAHSTFQQH 97 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 G++SYCI IH+L+RAGL DA+ALLES+ KN+ S Sbjct: 98 GLQSYCILIHILVRAGLNLDARALLESVLKKNSGS 132 >XP_015880277.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Ziziphus jujuba] Length = 551 Score = 124 bits (311), Expect = 3e-31 Identities = 59/95 (62%), Positives = 77/95 (81%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AIC S R GRNWD +S +FGSV+L + +V++VLLELK+P+DAK ALGFFHWSA + +H Sbjct: 38 AICCSLRAGRNWDILSRKFGSVDLDEVVVKKVLLELKEPVDAKRALGFFHWSAHSTFQQH 97 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 G++SYCI IH+L+RAGL DA+ALLES+ KN+ S Sbjct: 98 GLQSYCILIHILVRAGLNLDARALLESVLKKNSGS 132 >XP_010274732.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Nelumbo nucifera] Length = 578 Score = 122 bits (306), Expect = 2e-30 Identities = 52/91 (57%), Positives = 74/91 (81%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 +CDS RRG NWD +S F S++L+DS+VE++LLELK+P DA+ AL FFHWSA+ F+HG Sbjct: 51 VCDSLRRGGNWDTLSGNFDSIKLTDSVVEKILLELKEPADARRALSFFHWSARRKSFQHG 110 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKN 277 +RSYC+A+ +L+RA ++ DA+ALLES+ K+ Sbjct: 111 IRSYCVAVQILVRARMLNDARALLESVIRKS 141 >CAN82481.1 hypothetical protein VITISV_012747 [Vitis vinifera] Length = 642 Score = 122 bits (306), Expect = 2e-30 Identities = 58/94 (61%), Positives = 72/94 (76%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 +CDS RRG NWDA++ FGS+EL++S V +VLLELK PIDAK ALGFFHWSA+ +HG Sbjct: 44 LCDSLRRGLNWDALNQRFGSLELTESFVGRVLLELKKPIDAKQALGFFHWSAQCKNLEHG 103 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 V SYCI IH+L+ A L+ DA++LLES KN S Sbjct: 104 VASYCITIHILVGAHLLMDAQSLLESTLKKNAGS 137 >XP_003633738.2 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Vitis vinifera] Length = 549 Score = 121 bits (303), Expect = 4e-30 Identities = 57/94 (60%), Positives = 72/94 (76%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 +CDS RRG NWDA++ FGS+EL++S V +VLLELK PIDAK ALGFFHWSA+ +HG Sbjct: 46 LCDSLRRGLNWDALNQRFGSLELTESFVGRVLLELKKPIDAKQALGFFHWSAQCKNLEHG 105 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 + SYCI IH+L+ A L+ DA++LLES KN S Sbjct: 106 LASYCITIHILVGAQLLMDAQSLLESTLKKNAGS 139 >XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582097.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] Length = 557 Score = 121 bits (303), Expect = 4e-30 Identities = 58/94 (61%), Positives = 74/94 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AICDS RRG NW ++S +F VEL+ LVE+VLLELK+PIDAK ALGFFHWSA+ F H Sbjct: 49 AICDSLRRGHNWVSLSGKFQYVELNHLLVEKVLLELKEPIDAKRALGFFHWSAQRKNFVH 108 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTD 283 GV SYC+ +++L+RA L+ DA+ALLES+ KN + Sbjct: 109 GVWSYCLMVNILVRAQLLNDAQALLESILKKNVE 142 >EEF31203.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 121 bits (303), Expect = 5e-30 Identities = 58/94 (61%), Positives = 74/94 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AICDS RRG NW ++S +F VEL+ LVE+VLLELK+PIDAK ALGFFHWSA+ F H Sbjct: 49 AICDSLRRGHNWVSLSGKFQYVELNHLLVEKVLLELKEPIDAKRALGFFHWSAQRKNFVH 108 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTD 283 GV SYC+ +++L+RA L+ DA+ALLES+ KN + Sbjct: 109 GVWSYCLMVNILVRAQLLNDAQALLESILKKNVE 142 >XP_006430611.1 hypothetical protein CICLE_v10011485mg [Citrus clementina] ESR43851.1 hypothetical protein CICLE_v10011485mg [Citrus clementina] Length = 521 Score = 120 bits (301), Expect = 6e-30 Identities = 55/92 (59%), Positives = 72/92 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AICD FRRG NWD +S +F S+ L+DSLVE VLLELK+P+DAK ALGFFHWSA ++H Sbjct: 42 AICDCFRRGWNWDTLSKQFNSIHLNDSLVENVLLELKEPVDAKRALGFFHWSAHHKSYQH 101 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKN 277 + SY + IH+L+RA L+ DA+AL+ES+ K+ Sbjct: 102 NLCSYSVTIHILVRARLLVDARALIESVLEKH 133 >GAV76712.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 524 Score = 120 bits (300), Expect = 9e-30 Identities = 58/91 (63%), Positives = 73/91 (80%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 ICDS RRG NW+ +S +F SVEL++SLV+ VLLELK+P DAK ALGFFHWSA+ F+HG Sbjct: 50 ICDSLRRGWNWETLSRKFDSVELNESLVKTVLLELKEPTDAKCALGFFHWSAQRKGFEHG 109 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKN 277 + SY +AIH+L+RA L DAKALLES+ K+ Sbjct: 110 LWSYSLAIHILVRARLFMDAKALLESILKKS 140 >XP_013466859.1 PPR containing plant protein [Medicago truncatula] KEH40900.1 PPR containing plant protein [Medicago truncatula] Length = 547 Score = 120 bits (300), Expect = 1e-29 Identities = 57/100 (57%), Positives = 76/100 (76%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 +I +SFR +NWD ++ +F S++L+ SL EQ+LL L +P DAK AL FFHWS KTHRF+H Sbjct: 41 SISNSFRTKQNWDTITHKFTSIKLTPSLAEQILLNLNNPTDAKNALSFFHWSTKTHRFQH 100 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDSPAVRA 301 + SY I I++LL + L+TDAKALLES+A KNT + VRA Sbjct: 101 TLHSYSITINLLLHSNLLTDAKALLESIALKNTQTHTVRA 140 >XP_006482125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Citrus sinensis] Length = 553 Score = 119 bits (297), Expect = 3e-29 Identities = 54/92 (58%), Positives = 72/92 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 AICD FRRG NWD +S +F S+ L+DSLVE VLLELK+P+DAK ALGFFHWSA ++H Sbjct: 42 AICDCFRRGWNWDTLSKQFNSIHLNDSLVENVLLELKEPVDAKRALGFFHWSAHHKSYQH 101 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKN 277 + SY + IH+L++A L+ DA+AL+ES+ K+ Sbjct: 102 NLCSYSVTIHILVQARLLVDARALIESVLEKH 133 >XP_002305195.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE85706.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 556 Score = 119 bits (297), Expect = 3e-29 Identities = 56/96 (58%), Positives = 75/96 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 +ICDS RRG NWD ++ +F S++L++ LV+ VLLELK+P DAK ALGFFHWSA+ F H Sbjct: 49 SICDSLRRGYNWDTLNRKFESLQLNNLLVKNVLLELKEPTDAKRALGFFHWSAR-RNFVH 107 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDSP 289 GV+SYC+ IH+L++A L+ DA+ALLESL K+ P Sbjct: 108 GVQSYCLMIHILIQARLIMDAQALLESLLKKSVGDP 143 >XP_011002790.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Populus euphratica] XP_011002791.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Populus euphratica] Length = 556 Score = 118 bits (296), Expect = 4e-29 Identities = 56/96 (58%), Positives = 75/96 (78%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 +ICDS RRG NWD ++ +F S++L++ LV+ VLLELK+P DAK ALGFFHWSA+ F H Sbjct: 49 SICDSLRRGYNWDTLNRKFESLQLNNLLVKNVLLELKEPTDAKRALGFFHWSAR-RNFVH 107 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKNTDSP 289 GV+SYC+ IHVL++A L+ DA+ALLES+ K+ P Sbjct: 108 GVQSYCLMIHVLIQARLIMDAQALLESILKKSVGDP 143 >XP_018844095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Juglans regia] XP_018844096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Juglans regia] XP_018844097.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Juglans regia] XP_018844098.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Juglans regia] XP_018844099.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Juglans regia] Length = 550 Score = 118 bits (295), Expect = 5e-29 Identities = 54/92 (58%), Positives = 73/92 (79%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 +IC SFRRG NWD ++ +F + +L+D +VE+VLLELK+P DAK AL FFHWSA+ +H Sbjct: 49 SICSSFRRGWNWDRLTQKFDTFQLNDLIVEKVLLELKEPNDAKRALAFFHWSAQRKTIEH 108 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANKN 277 G+RSYCI IH+L+RA L+ DA+ALLES+ K+ Sbjct: 109 GIRSYCITIHILVRARLLMDARALLESVLKKS 140 >XP_010036957.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Eucalyptus grandis] Length = 572 Score = 118 bits (295), Expect = 6e-29 Identities = 54/91 (59%), Positives = 74/91 (81%) Frame = +2 Query: 2 AICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKH 181 A+ +S RRG +WDA++ +F + L D+LVE+VLLELK+P DA+ ALGFFHWSAK RF+H Sbjct: 49 ALSNSLRRGWSWDALNRKFEHLALDDALVERVLLELKEPADARCALGFFHWSAKERRFEH 108 Query: 182 GVRSYCIAIHVLLRAGLVTDAKALLESLANK 274 G+RSYC+AI++L+R LV DAKAL+ES+ + Sbjct: 109 GIRSYCVAINILVRGQLVRDAKALIESVLKR 139 >XP_010940143.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Elaeis guineensis] Length = 583 Score = 118 bits (295), Expect = 6e-29 Identities = 51/94 (54%), Positives = 75/94 (79%) Frame = +2 Query: 5 ICDSFRRGRNWDAVSCEFGSVELSDSLVEQVLLELKDPIDAKTALGFFHWSAKTHRFKHG 184 I + RG +WD++S FGS EL+ SLVE+VLL+LK+P+DAK AL FFHW+ + +F+HG Sbjct: 53 ISNLLNRGGSWDSLSSSFGSTELTQSLVERVLLDLKEPLDAKKALTFFHWTCQFRKFQHG 112 Query: 185 VRSYCIAIHVLLRAGLVTDAKALLESLANKNTDS 286 ++SYC+ +H+L+RAGL+ DA+ALLES+ KN ++ Sbjct: 113 LKSYCLIVHILVRAGLLIDARALLESVIRKNAEA 146