BLASTX nr result
ID: Glycyrrhiza32_contig00035912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035912 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016195237.1 PREDICTED: ankyrin repeat domain-containing prote... 56 1e-06 XP_017435218.1 PREDICTED: ankyrin repeat domain-containing prote... 55 2e-06 XP_015941132.1 PREDICTED: ankyrin repeat domain-containing prote... 54 6e-06 XP_007133101.1 hypothetical protein PHAVU_011G151700g [Phaseolus... 54 6e-06 >XP_016195237.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Arachis ipaensis] Length = 585 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = -1 Query: 367 RNNSQSGSKQQR---SLGAMDSDPFAIPAGYTWTNSKD 263 RNNS SGSKQQ+ S A+DSDPFAIPAGYTWT+ +D Sbjct: 533 RNNSHSGSKQQQRNCSSSALDSDPFAIPAGYTWTSVED 570 >XP_017435218.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Vigna angularis] BAT87464.1 hypothetical protein VIGAN_05083400 [Vigna angularis var. angularis] Length = 600 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = -1 Query: 364 NNSQSGSKQQR--SLGAMDSDPFAIPAGYTWTNSKDD 260 ++SQS SK Q+ S GA+DSDPFAIPAGYTWTNS DD Sbjct: 549 SSSQSWSKHQQRCSSGALDSDPFAIPAGYTWTNSGDD 585 >XP_015941132.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Arachis duranensis] Length = 584 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 3/38 (7%) Frame = -1 Query: 367 RNNSQSGSKQQR---SLGAMDSDPFAIPAGYTWTNSKD 263 RNNS SGSKQQ+ S A+DSDPFAIP+GYTWT+ D Sbjct: 532 RNNSHSGSKQQQRNCSSSALDSDPFAIPSGYTWTSVDD 569 >XP_007133101.1 hypothetical protein PHAVU_011G151700g [Phaseolus vulgaris] ESW05095.1 hypothetical protein PHAVU_011G151700g [Phaseolus vulgaris] Length = 592 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/37 (70%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = -1 Query: 364 NNSQSGSKQQR--SLGAMDSDPFAIPAGYTWTNSKDD 260 ++SQS SK Q+ S GA+DSDPF+IPAGYTWTNS DD Sbjct: 541 SSSQSWSKHQQRCSSGALDSDPFSIPAGYTWTNSGDD 577