BLASTX nr result
ID: Glycyrrhiza32_contig00035753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035753 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT78870.1 hypothetical protein VIGAN_02162200, partial [Vigna a... 52 1e-06 >BAT78870.1 hypothetical protein VIGAN_02162200, partial [Vigna angularis var. angularis] Length = 111 Score = 52.4 bits (124), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +3 Query: 15 CKSRHGVILIRLF*-KPCYHQFQMSRINITLVCFIAHISHFILF 143 CKSRHGVIL+ L +P YH + SRINITLVCFIA++ + F Sbjct: 68 CKSRHGVILVWLILIQPLYHLLETSRINITLVCFIAYVYSQLFF 111