BLASTX nr result
ID: Glycyrrhiza32_contig00035709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035709 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019445404.1 PREDICTED: cyclin-D4-2-like [Lupinus angustifoliu... 54 7e-06 >XP_019445404.1 PREDICTED: cyclin-D4-2-like [Lupinus angustifolius] OIW10605.1 hypothetical protein TanjilG_15977 [Lupinus angustifolius] Length = 354 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -1 Query: 423 SKSSDELTVGSCPNSSHNSPNITKRNNKSDGPSSNGTSES 304 S SDELTVGSCPN+S+NS N TK NKSDGPS+NG S Sbjct: 313 SFKSDELTVGSCPNTSYNSSN-TKMCNKSDGPSTNGAFTS 351