BLASTX nr result
ID: Glycyrrhiza32_contig00035618
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035618 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015932763.1 PREDICTED: organ-specific protein P4-like [Arachi... 52 5e-06 XP_003599528.2 specific tissue protein [Medicago truncatula] AES... 52 7e-06 CEQ38272.1 specific tissue protein 5 [Medicago truncatula] 52 7e-06 >XP_015932763.1 PREDICTED: organ-specific protein P4-like [Arachis duranensis] Length = 184 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/36 (63%), Positives = 29/36 (80%), Gaps = 3/36 (8%) Frame = -3 Query: 246 EPRPNISAYGNDDIDC---KEFVKDFEPRPSATKYD 148 EPRPN+SAYG++DID K+FVK FEPRP+ + YD Sbjct: 142 EPRPNVSAYGDNDIDAKKQKKFVKSFEPRPNVSVYD 177 >XP_003599528.2 specific tissue protein [Medicago truncatula] AES69779.2 specific tissue protein [Medicago truncatula] Length = 405 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = -3 Query: 246 EPRPNISAYGNDDIDC---KEFVKDFEPRPSATKYD 148 EPRPNIS YGN+DID +EF DFEP+PS TK D Sbjct: 369 EPRPNISGYGNNDIDADKNEEFTNDFEPKPSVTKSD 404 >CEQ38272.1 specific tissue protein 5 [Medicago truncatula] Length = 594 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = -3 Query: 246 EPRPNISAYGNDDIDC---KEFVKDFEPRPSATKYD 148 EPRPNIS YGN+DID +EF DFEP+PS TK D Sbjct: 558 EPRPNISGYGNNDIDADKNEEFTNDFEPKPSVTKSD 593