BLASTX nr result
ID: Glycyrrhiza32_contig00035237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035237 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003612382.1 LRR kinase family protein, putative [Medicago tru... 55 2e-07 XP_003612385.2 LRR receptor-like kinase family protein [Medicago... 55 1e-06 GAU15765.1 hypothetical protein TSUD_235810 [Trifolium subterran... 54 6e-06 >XP_003612382.1 LRR kinase family protein, putative [Medicago truncatula] AES95340.1 LRR kinase family protein, putative [Medicago truncatula] Length = 129 Score = 55.5 bits (132), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PKERMNIVDVTRELNIIKKAFLTGVH-S*VIKA*TNFRSHL 122 PKERMNIVDVTRELN+I+ FL GVH S VIK NFR HL Sbjct: 88 PKERMNIVDVTRELNLIRTIFLEGVHASRVIKPEINFRHHL 128 >XP_003612385.2 LRR receptor-like kinase family protein [Medicago truncatula] AES95343.2 LRR receptor-like kinase family protein [Medicago truncatula] Length = 1047 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PKERMNIVDVTRELNIIKKAFLTGVH-S*VIKA*TNFRSHL 122 PKERMNIVDVTRELN+I+ FL GVH S VIK NFR HL Sbjct: 1006 PKERMNIVDVTRELNLIRTIFLEGVHASRVIKPEINFRHHL 1046 >GAU15765.1 hypothetical protein TSUD_235810 [Trifolium subterraneum] Length = 702 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 3 PKERMNIVDVTRELNIIKKAFLTGVHS 83 PKERMNIVDVTREL+IIKKA+LTGVHS Sbjct: 674 PKERMNIVDVTRELSIIKKAYLTGVHS 700