BLASTX nr result
ID: Glycyrrhiza32_contig00035232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00035232 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU51167.1 hypothetical protein TSUD_412020 [Trifolium subterran... 79 1e-15 XP_006586762.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 79 1e-15 XP_013462896.1 strubbelig-receptor family protein [Medicago trun... 79 1e-15 OIW14006.1 hypothetical protein TanjilG_09357 [Lupinus angustifo... 79 2e-15 XP_019439840.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 79 2e-15 XP_006597598.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 78 3e-15 KYP62729.1 Protein STRUBBELIG-RECEPTOR FAMILY 8 [Cajanus cajan] 77 9e-15 XP_016711449.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 76 2e-14 XP_016711448.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 76 2e-14 XP_017616075.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 76 2e-14 XP_019424744.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 75 3e-14 XP_015959056.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 i... 75 4e-14 XP_015959055.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 i... 75 4e-14 XP_015959054.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 i... 75 4e-14 XP_004486188.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [... 74 6e-14 XP_014518920.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 i... 74 1e-13 XP_017437210.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [... 74 1e-13 BAT87497.1 hypothetical protein VIGAN_05087300 [Vigna angularis ... 74 1e-13 XP_014518919.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 i... 74 1e-13 XP_016723481.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-l... 74 1e-13 >GAU51167.1 hypothetical protein TSUD_412020 [Trifolium subterraneum] Length = 680 Score = 79.0 bits (193), Expect = 1e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHE+MD SF Sbjct: 641 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHESMDMSF 680 >XP_006586762.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine max] KHN40858.1 Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja] KRH36503.1 hypothetical protein GLYMA_09G007200 [Glycine max] Length = 711 Score = 79.0 bits (193), Expect = 1e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDH+AMD SF Sbjct: 672 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHDAMDMSF 711 >XP_013462896.1 strubbelig-receptor family protein [Medicago truncatula] KEH36931.1 strubbelig-receptor family protein [Medicago truncatula] Length = 729 Score = 79.0 bits (193), Expect = 1e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFGHKTPDHEAMD SF Sbjct: 690 EVVQALVRLVQRASVVKRRPSDESGFGHKTPDHEAMDISF 729 >OIW14006.1 hypothetical protein TanjilG_09357 [Lupinus angustifolius] Length = 702 Score = 78.6 bits (192), Expect = 2e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEA+D SF Sbjct: 663 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAIDMSF 702 >XP_019439840.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Lupinus angustifolius] Length = 716 Score = 78.6 bits (192), Expect = 2e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEA+D SF Sbjct: 677 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAIDMSF 716 >XP_006597598.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine max] KHN32995.1 Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja] KRH11488.1 hypothetical protein GLYMA_15G111600 [Glycine max] Length = 710 Score = 78.2 bits (191), Expect = 3e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMD F Sbjct: 671 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDMPF 710 >KYP62729.1 Protein STRUBBELIG-RECEPTOR FAMILY 8 [Cajanus cajan] Length = 713 Score = 76.6 bits (187), Expect = 9e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFGHKTPDHEA+D SF Sbjct: 674 EVVQALVRLVQRASVVKRRPSDESGFGHKTPDHEAIDTSF 713 >XP_016711449.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform X2 [Gossypium hirsutum] Length = 625 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFG+KTPDHEA DFSF Sbjct: 586 EVVQALVRLVQRASVVKRRPSDESGFGYKTPDHEAGDFSF 625 >XP_016711448.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform X1 [Gossypium hirsutum] Length = 726 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFG+KTPDHEA DFSF Sbjct: 687 EVVQALVRLVQRASVVKRRPSDESGFGYKTPDHEAGDFSF 726 >XP_017616075.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Gossypium arboreum] KHG11352.1 protein strubbelig-receptor family 8 [Gossypium arboreum] Length = 726 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFG+KTPDHEA DFSF Sbjct: 687 EVVQALVRLVQRASVVKRRPSDESGFGYKTPDHEAGDFSF 726 >XP_019424744.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Lupinus angustifolius] OIV91823.1 hypothetical protein TanjilG_17815 [Lupinus angustifolius] Length = 716 Score = 75.1 bits (183), Expect = 3e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRAS+VKRRPSEESG+GHKTPDHE++D SF Sbjct: 677 EVVQALVRLVQRASMVKRRPSEESGYGHKTPDHESIDMSF 716 >XP_015959056.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Arachis duranensis] Length = 599 Score = 74.7 bits (182), Expect = 4e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFGH+TP+HEA+D SF Sbjct: 560 EVVQALVRLVQRASVVKRRPSDESGFGHRTPEHEAIDMSF 599 >XP_015959055.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Arachis duranensis] Length = 619 Score = 74.7 bits (182), Expect = 4e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFGH+TP+HEA+D SF Sbjct: 580 EVVQALVRLVQRASVVKRRPSDESGFGHRTPEHEAIDMSF 619 >XP_015959054.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Arachis duranensis] Length = 641 Score = 74.7 bits (182), Expect = 4e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESGFGH+TP+HEA+D SF Sbjct: 602 EVVQALVRLVQRASVVKRRPSDESGFGHRTPEHEAIDMSF 641 >XP_004486188.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Cicer arietinum] Length = 680 Score = 74.3 bits (181), Expect = 6e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+E GFG+KTPDHEAMD SF Sbjct: 641 EVVQALVRLVQRASVVKRRPSDEYGFGYKTPDHEAMDMSF 680 >XP_014518920.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Vigna radiata var. radiata] Length = 574 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESG GHKTP+HEA+D SF Sbjct: 535 EVVQALVRLVQRASVVKRRPSDESGIGHKTPEHEAIDMSF 574 >XP_017437210.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vigna angularis] Length = 675 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESG GHKTP+HEA+D SF Sbjct: 636 EVVQALVRLVQRASVVKRRPSDESGIGHKTPEHEAIDMSF 675 >BAT87497.1 hypothetical protein VIGAN_05087300 [Vigna angularis var. angularis] Length = 712 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESG GHKTP+HEA+D SF Sbjct: 673 EVVQALVRLVQRASVVKRRPSDESGIGHKTPEHEAIDMSF 712 >XP_014518919.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Vigna radiata var. radiata] Length = 713 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+ESG GHKTP+HEA+D SF Sbjct: 674 EVVQALVRLVQRASVVKRRPSDESGIGHKTPEHEAIDMSF 713 >XP_016723481.1 PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Gossypium hirsutum] Length = 726 Score = 73.6 bits (179), Expect = 1e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 2 EVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAMDFSF 121 EVVQALVRLVQRASVVKRRPS+E GFG+KTPDHEA DFSF Sbjct: 687 EVVQALVRLVQRASVVKRRPSDELGFGYKTPDHEAGDFSF 726