BLASTX nr result
ID: Glycyrrhiza32_contig00034449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00034449 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004505419.1 PREDICTED: pentatricopeptide repeat-containing pr... 132 8e-33 XP_013456736.1 PPR containing plant protein [Medicago truncatula... 127 2e-31 GAU48836.1 hypothetical protein TSUD_406550 [Trifolium subterran... 123 7e-30 KYP46072.1 hypothetical protein KK1_032379 [Cajanus cajan] 109 5e-25 KHM99406.1 Pentatricopeptide repeat-containing protein, mitochon... 106 8e-24 XP_006602784.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 8e-24 XP_019428355.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 2e-23 OIV90407.1 hypothetical protein TanjilG_10707 [Lupinus angustifo... 105 2e-23 XP_014494750.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 9e-20 XP_017442859.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 1e-19 XP_014496497.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 5e-18 KRH67241.1 hypothetical protein GLYMA_03G156300 [Glycine max] 88 2e-17 XP_007162454.1 hypothetical protein PHAVU_001G153700g [Phaseolus... 84 7e-16 XP_015950095.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 2e-10 XP_015931943.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-09 XP_016166853.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-09 >XP_004505419.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Cicer arietinum] XP_004505420.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Cicer arietinum] XP_012572631.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Cicer arietinum] Length = 784 Score = 132 bits (331), Expect = 8e-33 Identities = 65/83 (78%), Positives = 73/83 (87%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI++LKTG DLP+VLCFM+ANCNYGTAQVSNNR L SI KFVSPC+AKSSS+A LLGF Sbjct: 1 MLAIRRLKTGPDLPYVLCFMIANCNYGTAQVSNNRNLQSIVKFVSPCLAKSSSKAFLLGF 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 +N F Q LYISSMAE ILVQA+ Sbjct: 61 KNTFFLQGLYISSMAETILVQAQ 83 >XP_013456736.1 PPR containing plant protein [Medicago truncatula] KEH30767.1 PPR containing plant protein [Medicago truncatula] Length = 786 Score = 127 bits (320), Expect = 2e-31 Identities = 63/83 (75%), Positives = 71/83 (85%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLK G DLP+VLC M+ANCNYGTAQVSN R+L SI KFV PC+AKSSS ALLLGF Sbjct: 1 MLAIRKLKKGPDLPYVLCLMIANCNYGTAQVSNKRSLQSIVKFVGPCLAKSSSTALLLGF 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 N+F Q LY+SSMAERILVQA+ Sbjct: 61 RNRFFLQGLYMSSMAERILVQAQ 83 >GAU48836.1 hypothetical protein TSUD_406550 [Trifolium subterraneum] Length = 717 Score = 123 bits (309), Expect = 7e-30 Identities = 61/83 (73%), Positives = 70/83 (84%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML IQKLKTG D PF+LCF+ AN NYGTAQVSNN++L SI KFV PC++KSSS +LL GF Sbjct: 1 MLVIQKLKTGPDRPFLLCFLTANYNYGTAQVSNNKSLQSIVKFVCPCVSKSSSTSLLFGF 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 +NKF Q LYISSMAERILVQA+ Sbjct: 61 KNKFFLQGLYISSMAERILVQAQ 83 >KYP46072.1 hypothetical protein KK1_032379 [Cajanus cajan] Length = 783 Score = 109 bits (273), Expect = 5e-25 Identities = 56/83 (67%), Positives = 63/83 (75%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLKTG D+PFVLC VANCNYGT +VSN++ + SI K V C A SSSQA LLG Sbjct: 1 MLAIRKLKTGPDIPFVLCVTVANCNYGTVRVSNSKNVRSIVKSVGSCSASSSSQAFLLGL 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q LY SS+ ERILVQAR Sbjct: 61 ENKHTLQGLYFSSVTERILVQAR 83 >KHM99406.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 784 Score = 106 bits (264), Expect = 8e-24 Identities = 56/83 (67%), Positives = 66/83 (79%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLKTG D+PFVL MVANCNYGTA+VS+N+++ SI K V +A SSSQA LG Sbjct: 1 MLAIRKLKTGPDIPFVLYVMVANCNYGTARVSSNKSVQSIVKSVGSYLANSSSQAFPLGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENKF Q LY SS+AERILVQA+ Sbjct: 61 ENKFTLQGLYFSSVAERILVQAQ 83 >XP_006602784.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Glycine max] KRH00692.1 hypothetical protein GLYMA_18G229500 [Glycine max] KRH00693.1 hypothetical protein GLYMA_18G229500 [Glycine max] Length = 784 Score = 106 bits (264), Expect = 8e-24 Identities = 56/83 (67%), Positives = 66/83 (79%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLKTG D+PFVL MVANCNYGTA+VS+N+++ SI K V +A SSSQA LG Sbjct: 1 MLAIRKLKTGPDIPFVLYVMVANCNYGTARVSSNKSVQSIVKSVGSYLANSSSQAFPLGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENKF Q LY SS+AERILVQA+ Sbjct: 61 ENKFTLQGLYFSSVAERILVQAQ 83 >XP_019428355.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Lupinus angustifolius] XP_019428356.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Lupinus angustifolius] XP_019428357.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Lupinus angustifolius] XP_019428358.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X2 [Lupinus angustifolius] Length = 783 Score = 105 bits (261), Expect = 2e-23 Identities = 56/83 (67%), Positives = 62/83 (74%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLK G DL FVLCFM+A CNY QVS +R SIFK VSPC+A S SQA LLG Sbjct: 1 MLAIRKLKRGPDLNFVLCFMIARCNYSIVQVSIDRNHQSIFKSVSPCLAYSRSQAFLLGP 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q LY SS+AERILVQA+ Sbjct: 61 ENKINLQELYFSSVAERILVQAQ 83 >OIV90407.1 hypothetical protein TanjilG_10707 [Lupinus angustifolius] Length = 1033 Score = 105 bits (261), Expect = 2e-23 Identities = 56/83 (67%), Positives = 62/83 (74%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLK G DL FVLCFM+A CNY QVS +R SIFK VSPC+A S SQA LLG Sbjct: 1 MLAIRKLKRGPDLNFVLCFMIARCNYSIVQVSIDRNHQSIFKSVSPCLAYSRSQAFLLGP 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q LY SS+AERILVQA+ Sbjct: 61 ENKINLQELYFSSVAERILVQAQ 83 >XP_014494750.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vigna radiata var. radiata] Length = 784 Score = 94.7 bits (234), Expect = 9e-20 Identities = 49/83 (59%), Positives = 58/83 (69%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML ++KLKTG D+P VL MVANCNY TAQVS+ +++ I K C+ KSSS LLG Sbjct: 1 MLGVRKLKTGPDIPLVLSVMVANCNYRTAQVSSGKSVRYIVKSAVSCLVKSSSSTFLLGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENKF Q LY SS AERILV A+ Sbjct: 61 ENKFSLQGLYFSSAAERILVHAQ 83 >XP_017442859.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vigna angularis] KOM25113.1 hypothetical protein LR48_Vigan50s003300 [Vigna angularis] BAT85464.1 hypothetical protein VIGAN_04301700 [Vigna angularis var. angularis] Length = 784 Score = 94.4 bits (233), Expect = 1e-19 Identities = 49/83 (59%), Positives = 59/83 (71%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML ++KLKTG D+P VL MVANCNY TAQVS+ +++ I K C+ KSSS A LLG Sbjct: 1 MLGVRKLKTGPDIPLVLSVMVANCNYRTAQVSSGKSVRYIVKSAVSCLVKSSSSAFLLGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 NKF Q LY SS+AERILV A+ Sbjct: 61 GNKFSLQGLYFSSVAERILVHAQ 83 >XP_014496497.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Vigna radiata var. radiata] Length = 776 Score = 89.7 bits (221), Expect = 5e-18 Identities = 48/83 (57%), Positives = 60/83 (72%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML ++KLKT S++P VL MVAN NY T QVS+++++ I K V C+AKSSS A L G Sbjct: 1 MLRVRKLKTESNIPLVLSVMVANYNYRTTQVSSDKSVRYIVKLVVSCLAKSSSSAFLPGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENKF Q LY SS+AERILV A+ Sbjct: 61 ENKFALQGLYFSSVAERILVHAQ 83 >KRH67241.1 hypothetical protein GLYMA_03G156300 [Glycine max] Length = 759 Score = 87.8 bits (216), Expect = 2e-17 Identities = 45/73 (61%), Positives = 55/73 (75%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLKTG D+PFVL M ANCNYGTA+VS+N+++ SI K V +A SS QA LG Sbjct: 1 MLAIRKLKTGPDIPFVLYVMAANCNYGTARVSSNKSVQSIVKSVGSYLANSSWQAFPLGS 60 Query: 385 ENKFIPQRLYISS 423 ENKF Q LY+S+ Sbjct: 61 ENKFALQGLYVST 73 >XP_007162454.1 hypothetical protein PHAVU_001G153700g [Phaseolus vulgaris] ESW34448.1 hypothetical protein PHAVU_001G153700g [Phaseolus vulgaris] Length = 785 Score = 83.6 bits (205), Expect = 7e-16 Identities = 46/83 (55%), Positives = 57/83 (68%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 MLAI+KLKTG D+P VL MVANC+Y A+VS+++ + K V + KSSS A G Sbjct: 1 MLAIRKLKTGPDIPLVLGVMVANCSYRIARVSSDKNVRYTVKSVVSSLVKSSSSAFPPGS 60 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENKF Q LY SS+AERILV A+ Sbjct: 61 ENKFTLQGLYFSSVAERILVHAK 83 >XP_015950095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015950096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] Length = 782 Score = 68.2 bits (165), Expect = 2e-10 Identities = 38/83 (45%), Positives = 52/83 (62%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML ++KLK G D+ + F++ANC++ AQ+ N+ I K +S ++ S SQA LL F Sbjct: 1 MLTVRKLKIGPDITYA--FIIANCHHSVAQIFNSSCYKPIVKSISSYLSNSRSQARLLRF 58 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q L SS+ E ILVQAR Sbjct: 59 ENKVTLQGLCFSSVLETILVQAR 81 >XP_015931943.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931944.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931945.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931946.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931947.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931948.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931949.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931950.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] XP_015931951.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Arachis duranensis] Length = 782 Score = 65.9 bits (159), Expect = 1e-09 Identities = 41/83 (49%), Positives = 49/83 (59%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML I+KLK D+ F++ANC+ AQV NN I K +S +A SS QA LL Sbjct: 1 MLTIRKLKIKPDI--TSAFIIANCHQSVAQVFNNSCHKPIVKSISSYLANSSLQARLLRL 58 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q LY SS+ E ILVQAR Sbjct: 59 ENKVTFQGLYFSSVPETILVQAR 81 >XP_016166853.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166854.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166855.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166856.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166857.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166858.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166859.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166861.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166862.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] XP_016166863.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Arachis ipaensis] Length = 782 Score = 65.1 bits (157), Expect = 2e-09 Identities = 41/83 (49%), Positives = 49/83 (59%) Frame = +1 Query: 205 MLAIQKLKTGSDLPFVLCFMVANCNYGTAQVSNNRTLHSIFKFVSPCIAKSSSQALLLGF 384 ML I+KLK D+ F++AN + AQV NN I K +S +A SSSQA LL Sbjct: 1 MLTIRKLKIRPDI--TSAFIIANRRHSVAQVFNNSCHKPIVKSISSYLANSSSQARLLRL 58 Query: 385 ENKFIPQRLYISSMAERILVQAR 453 ENK Q LY SS+ E ILVQAR Sbjct: 59 ENKVTFQELYFSSVPETILVQAR 81