BLASTX nr result
ID: Glycyrrhiza32_contig00034340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00034340 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU22886.1 unknown [Glycine max] 53 4e-06 KRH11594.1 hypothetical protein GLYMA_15G118900 [Glycine max] 53 1e-05 >ACU22886.1 unknown [Glycine max] Length = 155 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 125 MLRSLPKLSLIFSSTRNPRYLPNAQRFISSG 33 MLRSLPKLSL+FSS RNP YL +AQRFIS G Sbjct: 1 MLRSLPKLSLLFSSARNPHYLSSAQRFISQG 31 >KRH11594.1 hypothetical protein GLYMA_15G118900 [Glycine max] Length = 236 Score = 52.8 bits (125), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 125 MLRSLPKLSLIFSSTRNPRYLPNAQRFISSG 33 MLRSLPKLSL+FSS RNP YL +AQRFIS G Sbjct: 1 MLRSLPKLSLLFSSARNPHYLSSAQRFISQG 31