BLASTX nr result
ID: Glycyrrhiza32_contig00034319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00034319 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019416124.1 PREDICTED: uncharacterized protein LOC109327435 [... 53 4e-06 >XP_019416124.1 PREDICTED: uncharacterized protein LOC109327435 [Lupinus angustifolius] OIV97451.1 hypothetical protein TanjilG_16212 [Lupinus angustifolius] Length = 198 Score = 53.1 bits (126), Expect = 4e-06 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -3 Query: 284 VRDKDVQGQCGSLSFSSIPGSPLNIHKCSNGFRGCYPFANMKNATM 147 +R+KD G+ SFSS S L HKCSNGFRGCYPF NMKNAT+ Sbjct: 153 MREKDYGDGEGNHSFSS-SRSHLK-HKCSNGFRGCYPFGNMKNATI 196