BLASTX nr result
ID: Glycyrrhiza32_contig00034302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00034302 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019460676.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 3e-08 >XP_019460676.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Lupinus angustifolius] Length = 921 Score = 58.9 bits (141), Expect = 3e-08 Identities = 32/68 (47%), Positives = 38/68 (55%) Frame = +1 Query: 43 MHGSLTSTTFSSPKMRFLTSFINPTDTLLLFHXXXXXXXXXXXXPHLGTLHPHPRDYLPS 222 MHGS T F PKM+ LTSF P +TL L H + T+HPHP + +PS Sbjct: 1 MHGSFI-TFFLYPKMKSLTSFFIPRNTLFLIHFTKSISSIASLPHTVTTVHPHPPNDIPS 59 Query: 223 HLLTILSH 246 HL TILSH Sbjct: 60 HLFTILSH 67