BLASTX nr result
ID: Glycyrrhiza32_contig00034082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00034082 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK39514.1 unknown [Lotus japonicus] 58 9e-09 XP_014512209.1 PREDICTED: lipoyl synthase, chloroplastic [Vigna ... 61 1e-08 XP_017413394.1 PREDICTED: lipoyl synthase, chloroplastic [Vigna ... 61 1e-08 GAU34300.1 hypothetical protein TSUD_20060 [Trifolium subterraneum] 60 3e-08 GAU34299.1 hypothetical protein TSUD_20050 [Trifolium subterraneum] 60 3e-08 XP_004514720.1 PREDICTED: lipoyl synthase, chloroplastic [Cicer ... 60 4e-08 KRH36029.1 hypothetical protein GLYMA_10G279500 [Glycine max] 59 6e-08 KHN37416.1 Lipoyl synthase, chloroplastic [Glycine soja] 59 7e-08 XP_007142845.1 hypothetical protein PHAVU_007G021800g [Phaseolus... 57 3e-07 XP_003555873.1 PREDICTED: lipoyl synthase, chloroplastic [Glycin... 57 3e-07 KYP69158.1 hypothetical protein KK1_008343 [Cajanus cajan] 56 8e-07 XP_019428028.1 PREDICTED: lipoyl synthase, chloroplastic [Lupinu... 55 1e-06 XP_013467358.1 lipoyl synthase [Medicago truncatula] KEH41395.1 ... 55 1e-06 XP_016176754.1 PREDICTED: lipoyl synthase 1, chloroplastic [Arac... 55 2e-06 XP_015942135.1 PREDICTED: lipoyl synthase 1, chloroplastic [Arac... 55 2e-06 XP_011070495.1 PREDICTED: lipoyl synthase, chloroplastic [Sesamu... 54 3e-06 KNA24449.1 hypothetical protein SOVF_015760 [Spinacia oleracea] 54 5e-06 XP_006468685.1 PREDICTED: lipoyl synthase, chloroplastic [Citrus... 53 1e-05 >AFK39514.1 unknown [Lotus japonicus] Length = 104 Score = 58.2 bits (139), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREKTKN G S Sbjct: 73 ASGPLVRSSYRAGELFVKTMVREKTKNDGKS 103 >XP_014512209.1 PREDICTED: lipoyl synthase, chloroplastic [Vigna radiata var. radiata] Length = 364 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREKTKNAG S Sbjct: 334 ASGPLVRSSYRAGELFVKTMVREKTKNAGDS 364 >XP_017413394.1 PREDICTED: lipoyl synthase, chloroplastic [Vigna angularis] KOM36377.1 hypothetical protein LR48_Vigan02g252700 [Vigna angularis] BAT93712.1 hypothetical protein VIGAN_08024000 [Vigna angularis var. angularis] Length = 364 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREKTKNAG S Sbjct: 334 ASGPLVRSSYRAGELFVKTMVREKTKNAGDS 364 >GAU34300.1 hypothetical protein TSUD_20060 [Trifolium subterraneum] Length = 330 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMVREKTKNA GS Sbjct: 298 ASGPLVRSSYRAGELFVQTMVREKTKNANGS 328 >GAU34299.1 hypothetical protein TSUD_20050 [Trifolium subterraneum] Length = 357 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMVREKTKNA GS Sbjct: 325 ASGPLVRSSYRAGELFVQTMVREKTKNANGS 355 >XP_004514720.1 PREDICTED: lipoyl synthase, chloroplastic [Cicer arietinum] Length = 385 Score = 59.7 bits (143), Expect = 4e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREKTKN GS Sbjct: 353 ASGPLVRSSYRAGELFVKTMVREKTKNTSGS 383 >KRH36029.1 hypothetical protein GLYMA_10G279500 [Glycine max] Length = 349 Score = 58.9 bits (141), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREK KNAG S Sbjct: 317 ASGPLVRSSYRAGELFVKTMVREKAKNAGDS 347 >KHN37416.1 Lipoyl synthase, chloroplastic [Glycine soja] Length = 357 Score = 58.9 bits (141), Expect = 7e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREK KNAG S Sbjct: 325 ASGPLVRSSYRAGELFVKTMVREKAKNAGDS 355 >XP_007142845.1 hypothetical protein PHAVU_007G021800g [Phaseolus vulgaris] ESW14839.1 hypothetical protein PHAVU_007G021800g [Phaseolus vulgaris] Length = 364 Score = 57.0 bits (136), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREK+KNA S Sbjct: 334 ASGPLVRSSYRAGELFVKTMVREKSKNAADS 364 >XP_003555873.1 PREDICTED: lipoyl synthase, chloroplastic [Glycine max] KHN11467.1 Lipoyl synthase, chloroplastic [Glycine soja] KRG90716.1 hypothetical protein GLYMA_20G110200 [Glycine max] Length = 364 Score = 57.0 bits (136), Expect = 3e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFVKTMVREKTKN S Sbjct: 332 ASGPLVRSSYRAGELFVKTMVREKTKNVADS 362 >KYP69158.1 hypothetical protein KK1_008343 [Cajanus cajan] Length = 361 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAG 245 ASGPLVRSSYRAGELFV+TM+REK KNAG Sbjct: 330 ASGPLVRSSYRAGELFVQTMIREKAKNAG 358 >XP_019428028.1 PREDICTED: lipoyl synthase, chloroplastic [Lupinus angustifolius] OIV90961.1 hypothetical protein TanjilG_16921 [Lupinus angustifolius] Length = 377 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAG 245 ASGPLVRSSYRAGELFVKTMVREK KN G Sbjct: 345 ASGPLVRSSYRAGELFVKTMVREKVKNDG 373 >XP_013467358.1 lipoyl synthase [Medicago truncatula] KEH41395.1 lipoyl synthase [Medicago truncatula] Length = 389 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMVRE KNA GS Sbjct: 357 ASGPLVRSSYRAGELFVQTMVRESAKNADGS 387 >XP_016176754.1 PREDICTED: lipoyl synthase 1, chloroplastic [Arachis ipaensis] Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMVREK K AG S Sbjct: 348 ASGPLVRSSYRAGELFVQTMVREKAKTAGDS 378 >XP_015942135.1 PREDICTED: lipoyl synthase 1, chloroplastic [Arachis duranensis] Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMVREK K AG S Sbjct: 348 ASGPLVRSSYRAGELFVQTMVREKAKTAGDS 378 >XP_011070495.1 PREDICTED: lipoyl synthase, chloroplastic [Sesamum indicum] Length = 371 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNA 248 ASGPLVRSSYRAGELFVKTMV+EK KNA Sbjct: 339 ASGPLVRSSYRAGELFVKTMVKEKAKNA 366 >KNA24449.1 hypothetical protein SOVF_015760 [Spinacia oleracea] Length = 383 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKNAGGS 239 ASGPLVRSSYRAGELFV+TMV+E+TK GS Sbjct: 351 ASGPLVRSSYRAGELFVQTMVKERTKGTSGS 381 >XP_006468685.1 PREDICTED: lipoyl synthase, chloroplastic [Citrus sinensis] KDO77036.1 hypothetical protein CISIN_1g018731mg [Citrus sinensis] Length = 351 Score = 52.8 bits (125), Expect = 1e-05 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 331 ASGPLVRSSYRAGELFVKTMVREKTKN 251 ASGPLVRSSYRAGELFVKTMVRE+ KN Sbjct: 320 ASGPLVRSSYRAGELFVKTMVRERAKN 346