BLASTX nr result
ID: Glycyrrhiza32_contig00033716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00033716 (174 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU50493.1 hypothetical protein TSUD_26860 [Trifolium subterraneum] 69 3e-14 KHN27791.1 TMV resistance protein N [Glycine soja] 70 1e-13 XP_003607692.1 disease resistance protein (TIR-NBS-LRR class) [M... 73 1e-13 GAU40525.1 hypothetical protein TSUD_92970 [Trifolium subterraneum] 69 2e-13 XP_012572627.1 PREDICTED: TMV resistance protein N-like [Cicer a... 71 4e-13 ALN97041.1 disease resistance protein [Caragana korshinskii] 71 4e-13 XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [M... 70 8e-13 XP_006592480.1 PREDICTED: TMV resistance protein N-like [Glycine... 70 1e-12 KYP44283.1 TMV resistance protein N [Cajanus cajan] 67 1e-12 XP_012572633.1 PREDICTED: TMV resistance protein N-like [Cicer a... 69 2e-12 GAU18045.1 hypothetical protein TSUD_51560 [Trifolium subterraneum] 69 3e-12 XP_003619066.2 toll-interleukin-resistance (TIR) domain protein ... 69 4e-12 XP_003607596.1 disease resistance protein (TIR-NBS-LRR class) [M... 69 4e-12 GAU45382.1 hypothetical protein TSUD_90020 [Trifolium subterraneum] 64 8e-12 XP_016743233.1 PREDICTED: TMV resistance protein N-like [Gossypi... 67 1e-11 XP_016702039.1 PREDICTED: TMV resistance protein N-like [Gossypi... 67 1e-11 KYP33334.1 TMV resistance protein N [Cajanus cajan] 67 1e-11 AHG28999.1 NBS-LRR protein [Cicer arietinum] 67 1e-11 XP_016755173.1 PREDICTED: TMV resistance protein N-like [Gossypi... 65 1e-11 XP_012572624.1 PREDICTED: uncharacterized protein LOC101502375 [... 67 1e-11 >GAU50493.1 hypothetical protein TSUD_26860 [Trifolium subterraneum] Length = 79 Score = 69.3 bits (168), Expect = 3e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -2 Query: 122 VTRKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +T KYDVFVSFRGEDT NFTDHLFGA Q KGI AFRDDT Sbjct: 14 MTWKYDVFVSFRGEDTGNNFTDHLFGALQGKGIVAFRDDT 53 >KHN27791.1 TMV resistance protein N [Glycine soja] Length = 169 Score = 70.1 bits (170), Expect = 1e-13 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +KY+VFVSFRG+DTR NFTDHLFGA QRKGI FRDDT Sbjct: 17 KKYEVFVSFRGKDTRNNFTDHLFGALQRKGILTFRDDT 54 >XP_003607692.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89889.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1181 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDVFV+FRGEDTR+NFTDHLF A QRKGIFAFRDDT Sbjct: 78 YDVFVTFRGEDTRFNFTDHLFAALQRKGIFAFRDDT 113 >GAU40525.1 hypothetical protein TSUD_92970 [Trifolium subterraneum] Length = 168 Score = 69.3 bits (168), Expect = 2e-13 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDVFVSFRG+DTR+NFTDHLF FQRKGI FRDDT Sbjct: 21 YDVFVSFRGKDTRFNFTDHLFATFQRKGIITFRDDT 56 >XP_012572627.1 PREDICTED: TMV resistance protein N-like [Cicer arietinum] Length = 1002 Score = 71.2 bits (173), Expect = 4e-13 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDVFVSFRGEDTRYNFT HLF A QRKGIF FRDDT Sbjct: 13 YDVFVSFRGEDTRYNFTHHLFAALQRKGIFVFRDDT 48 >ALN97041.1 disease resistance protein [Caragana korshinskii] Length = 1056 Score = 71.2 bits (173), Expect = 4e-13 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +KYDVFVSFRG DTR NFTDHLFGA QRKGI AFRDDT Sbjct: 22 KKYDVFVSFRGMDTRCNFTDHLFGALQRKGITAFRDDT 59 >XP_003607597.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89794.2 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1054 Score = 70.5 bits (171), Expect = 8e-13 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDVFV+FRGEDTR+NF DHLF A QRKGIFAFRDDT Sbjct: 22 YDVFVTFRGEDTRFNFIDHLFAALQRKGIFAFRDDT 57 >XP_006592480.1 PREDICTED: TMV resistance protein N-like [Glycine max] KRH25828.1 hypothetical protein GLYMA_12G132200 [Glycine max] Length = 1087 Score = 70.1 bits (170), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +KY+VFVSFRG+DTR NFTDHLFGA QRKGI FRDDT Sbjct: 17 KKYEVFVSFRGKDTRNNFTDHLFGALQRKGILTFRDDT 54 >KYP44283.1 TMV resistance protein N [Cajanus cajan] Length = 170 Score = 67.4 bits (163), Expect = 1e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +KYDVFVSFRG+DTR NFTDH F A RKGI AFRDDT Sbjct: 18 KKYDVFVSFRGKDTRNNFTDHFFAALHRKGILAFRDDT 55 >XP_012572633.1 PREDICTED: TMV resistance protein N-like [Cicer arietinum] AHB79184.1 TIR-NBS-LRR disease resistance protein [Cicer arietinum] Length = 1057 Score = 69.3 bits (168), Expect = 2e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDVF++FRG+DTRYNFTD LF A QRKGIFAFRDDT Sbjct: 24 YDVFITFRGKDTRYNFTDQLFNALQRKGIFAFRDDT 59 >GAU18045.1 hypothetical protein TSUD_51560 [Trifolium subterraneum] Length = 633 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 113 KYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 KYDVFVSFRGEDTR NFTDHLFGA +KGI FRDDT Sbjct: 17 KYDVFVSFRGEDTRNNFTDHLFGALHKKGIVTFRDDT 53 >XP_003619066.2 toll-interleukin-resistance (TIR) domain protein [Medicago truncatula] AES75284.2 toll-interleukin-resistance (TIR) domain protein [Medicago truncatula] Length = 400 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 125 LVTRKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 LV YDVFVSFRG DTR+NFTDHLF A QR+GI AFRDDT Sbjct: 204 LVEINYDVFVSFRGPDTRFNFTDHLFAALQRRGINAFRDDT 244 Score = 50.8 bits (120), Expect = 7e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDD 6 +KY VFV+FR DT FT HL+GA QRKGI F DD Sbjct: 34 KKYGVFVNFRNADTLCTFTCHLYGALQRKGILTFMDD 70 >XP_003607596.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89793.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 1039 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDD 6 YDVFV+FRGEDTR+NF DHLF A QRKGIFAFRDD Sbjct: 22 YDVFVTFRGEDTRFNFIDHLFAALQRKGIFAFRDD 56 >GAU45382.1 hypothetical protein TSUD_90020 [Trifolium subterraneum] Length = 94 Score = 63.5 bits (153), Expect = 8e-12 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 110 YDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 YDV VSFRGEDTR NF+DHLFGA RKGI FRDDT Sbjct: 25 YDVSVSFRGEDTRNNFSDHLFGALHRKGIVTFRDDT 60 >XP_016743233.1 PREDICTED: TMV resistance protein N-like [Gossypium hirsutum] Length = 621 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 113 KYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDD 6 KYDVF+SFRGEDTR NFTDHL+ AF+R+GI AFRDD Sbjct: 28 KYDVFLSFRGEDTRQNFTDHLYAAFKRRGIIAFRDD 63 >XP_016702039.1 PREDICTED: TMV resistance protein N-like [Gossypium hirsutum] Length = 621 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 113 KYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDD 6 KYDVF+SFRGEDTR NFTDHL+ AF+R+GI AFRDD Sbjct: 28 KYDVFLSFRGEDTRQNFTDHLYAAFKRRGIIAFRDD 63 >KYP33334.1 TMV resistance protein N [Cajanus cajan] Length = 859 Score = 67.4 bits (163), Expect = 1e-11 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 +KYDVFVSFRG+DTR NFTDH F A RKGI AFRDDT Sbjct: 18 KKYDVFVSFRGKDTRNNFTDHFFAALHRKGILAFRDDT 55 >AHG28999.1 NBS-LRR protein [Cicer arietinum] Length = 989 Score = 67.0 bits (162), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 125 LVTRKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 L+ RKYDVFVSFRGE TR+NF DHLFGA +RK I+AFRDDT Sbjct: 3 LLQRKYDVFVSFRGE-TRHNFIDHLFGALRRKNIYAFRDDT 42 >XP_016755173.1 PREDICTED: TMV resistance protein N-like [Gossypium hirsutum] Length = 166 Score = 64.7 bits (156), Expect = 1e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 116 RKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDD 6 +KYDVF+SFRGEDTR NFTDHL+ A QR+GI FRDD Sbjct: 14 KKYDVFLSFRGEDTRNNFTDHLYNALQRRGIVIFRDD 50 >XP_012572624.1 PREDICTED: uncharacterized protein LOC101502375 [Cicer arietinum] Length = 1845 Score = 67.0 bits (162), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 125 LVTRKYDVFVSFRGEDTRYNFTDHLFGAFQRKGIFAFRDDT 3 L+ RKYDVFVSFRGE TR+NF DHLFGA +RK I+AFRDDT Sbjct: 859 LLQRKYDVFVSFRGE-TRHNFIDHLFGALRRKNIYAFRDDT 898