BLASTX nr result
ID: Glycyrrhiza32_contig00033337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00033337 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013468935.1 hypothetical protein MTR_1g079465 [Medicago trunc... 51 2e-06 >XP_013468935.1 hypothetical protein MTR_1g079465 [Medicago truncatula] KEH42972.1 hypothetical protein MTR_1g079465 [Medicago truncatula] Length = 58 Score = 50.8 bits (120), Expect = 2e-06 Identities = 23/50 (46%), Positives = 28/50 (56%) Frame = -2 Query: 198 IMTPVAWAQGDTIPSHLFLQEKFPQFLPCTRTEPPYVRRWICELSLPSFK 49 + T WAQ +T+P+ LQEK QF CTR E YV RWI P F+ Sbjct: 8 VTTEEVWAQHETVPNFFLLQEKSSQFFLCTRAEQSYVVRWIVTCLCPFFR 57