BLASTX nr result
ID: Glycyrrhiza32_contig00033321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00033321 (547 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004495572.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 2e-13 XP_014628528.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-12 XP_017410977.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-10 XP_014513289.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 5e-10 XP_007144015.1 hypothetical protein PHAVU_007G122000g [Phaseolus... 66 2e-09 >XP_004495572.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Cicer arietinum] XP_004495573.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Cicer arietinum] Length = 578 Score = 77.8 bits (190), Expect = 2e-13 Identities = 44/83 (53%), Positives = 52/83 (62%), Gaps = 14/83 (16%) Frame = +3 Query: 339 MRHTASLQNNICSFHSLIGLHGRNSQGTCISGDSSDHSSRK-------------NYPLSW 479 MRHT S QN SFHSL HGRN+QG+C+ G SS+HSSRK N W Sbjct: 1 MRHTTSFQNKSFSFHSLNDPHGRNNQGSCVFGTSSNHSSRKIMSSLHQNDCFSTNRCSYW 60 Query: 480 RGLQCRSLRASVLIDRVG-EVDH 545 +GL+CRSL A++L DRV EVDH Sbjct: 61 KGLRCRSLYATLLNDRVDYEVDH 83 >XP_014628528.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Glycine max] KRG92629.1 hypothetical protein GLYMA_20G222900 [Glycine max] KRG92630.1 hypothetical protein GLYMA_20G222900 [Glycine max] Length = 589 Score = 73.6 bits (179), Expect = 5e-12 Identities = 43/88 (48%), Positives = 50/88 (56%), Gaps = 19/88 (21%) Frame = +3 Query: 339 MRHTASLQNNICSFHSLIGLHGRNSQGTCISGDSS--DHSSRKN---------------- 464 M H A+LQ+NI SFHSL GLH N Q +CI G S DHS RK Sbjct: 1 MGHIATLQHNIFSFHSLNGLHICNKQESCILGACSALDHSLRKKTPTLHRICFGDYFSTT 60 Query: 465 -YPLSWRGLQCRSLRASVLIDRVGEVDH 545 Y + W+GL+CRS + SVLIDR EVDH Sbjct: 61 KYSIPWKGLRCRSFQRSVLIDRANEVDH 88 >XP_017410977.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna angularis] XP_017410979.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna angularis] KOM29997.1 hypothetical protein LR48_Vigan845s002500 [Vigna angularis] BAT94932.1 hypothetical protein VIGAN_08158400 [Vigna angularis var. angularis] Length = 590 Score = 68.2 bits (165), Expect = 4e-10 Identities = 40/88 (45%), Positives = 49/88 (55%), Gaps = 19/88 (21%) Frame = +3 Query: 339 MRHTASLQNNICSFHSLIGLHGRNSQGTCISGDSS--DHSSRK----------------- 461 M H +LQNN SFHSL GL G N + +CI G +S DHSSRK Sbjct: 1 MGHIGTLQNNFLSFHSLNGLLGCNKEESCIFGANSAPDHSSRKEPPTLHRLYFGDYFCST 60 Query: 462 NYPLSWRGLQCRSLRASVLIDRVGEVDH 545 Y W+GL+C+S SVLIDRV EV++ Sbjct: 61 KYHFPWKGLRCKSFHGSVLIDRVVEVEN 88 >XP_014513289.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna radiata var. radiata] XP_014513290.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna radiata var. radiata] Length = 590 Score = 67.8 bits (164), Expect = 5e-10 Identities = 40/88 (45%), Positives = 49/88 (55%), Gaps = 19/88 (21%) Frame = +3 Query: 339 MRHTASLQNNICSFHSLIGLHGRNSQGTCISGDSS--DHSSRKNYPLS------------ 476 M H +LQNNI HSL GL G N + +CI G +S DHSSRK P+ Sbjct: 1 MGHIGTLQNNILGSHSLNGLLGCNKEESCIFGGNSALDHSSRKESPIRHRVYFGDYFCST 60 Query: 477 -----WRGLQCRSLRASVLIDRVGEVDH 545 W+GL+C+S SVLIDRV EVD+ Sbjct: 61 KYHFPWKGLRCKSFHGSVLIDRVVEVDN 88 >XP_007144015.1 hypothetical protein PHAVU_007G122000g [Phaseolus vulgaris] ESW16009.1 hypothetical protein PHAVU_007G122000g [Phaseolus vulgaris] Length = 589 Score = 66.2 bits (160), Expect = 2e-09 Identities = 41/88 (46%), Positives = 48/88 (54%), Gaps = 19/88 (21%) Frame = +3 Query: 339 MRHTASLQNNICSFHSLIGLHGRNSQGTCISGDSSD--HSSRKN---------------- 464 M H A+LQNN+ S HSL GL G N + +CI SS HSSRK Sbjct: 1 MGHIATLQNNVFSSHSLNGLLGCNKEESCILCASSALVHSSRKKPPTLHRIYFGDYFCST 60 Query: 465 -YPLSWRGLQCRSLRASVLIDRVGEVDH 545 Y W+GL+CRS + SVLIDRV E DH Sbjct: 61 KYSFPWKGLRCRSFQGSVLIDRVIEADH 88