BLASTX nr result
ID: Glycyrrhiza32_contig00033080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00033080 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU27026.1 hypothetical protein TSUD_313880, partial [Trifolium ... 75 7e-13 XP_003603312.1 two-component response regulator ARR12-like prote... 71 1e-11 XP_007136966.1 hypothetical protein PHAVU_009G088800g [Phaseolus... 62 4e-10 XP_012571682.1 PREDICTED: two-component response regulator ARR12... 66 8e-10 ACU18185.1 unknown [Glycine max] 63 5e-09 KHN07036.1 Two-component response regulator ARR12 [Glycine soja] 63 7e-09 XP_003526216.1 PREDICTED: two-component response regulator ARR12... 63 7e-09 XP_015945363.1 PREDICTED: two-component response regulator ARR10... 63 9e-09 XP_016180768.1 PREDICTED: two-component response regulator ARR12... 63 9e-09 XP_019437783.1 PREDICTED: two-component response regulator ARR12... 59 2e-07 XP_019437782.1 PREDICTED: two-component response regulator ARR12... 59 2e-07 XP_014501987.1 PREDICTED: two-component response regulator ORR24... 57 1e-06 KOM42040.1 hypothetical protein LR48_Vigan04g223800 [Vigna angul... 55 3e-06 XP_017422392.1 PREDICTED: two-component response regulator ARR12... 55 3e-06 >GAU27026.1 hypothetical protein TSUD_313880, partial [Trifolium subterraneum] Length = 657 Score = 74.7 bits (182), Expect = 7e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NNLGSLEYL SMMEQEQDKMKLLGGD ICD+YSGGVSL Sbjct: 619 NNLGSLEYLASSMMEQEQDKMKLLGGDFICDSYSGGVSL 657 >XP_003603312.1 two-component response regulator ARR12-like protein [Medicago truncatula] AES73563.1 two-component response regulator ARR12-like protein [Medicago truncatula] Length = 645 Score = 71.2 bits (173), Expect = 1e-11 Identities = 34/39 (87%), Positives = 34/39 (87%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NNLGSLEYL SMM QEQDKMKLLGGD ICDNYS GVSL Sbjct: 607 NNLGSLEYLASSMMGQEQDKMKLLGGDFICDNYSDGVSL 645 >XP_007136966.1 hypothetical protein PHAVU_009G088800g [Phaseolus vulgaris] ESW08960.1 hypothetical protein PHAVU_009G088800g [Phaseolus vulgaris] Length = 73 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 +NLGSLE LV SMM+QE+D++KLL G+LICDNYSGG+S+ Sbjct: 35 SNLGSLEDLVSSMMKQEKDRLKLLDGNLICDNYSGGLSM 73 >XP_012571682.1 PREDICTED: two-component response regulator ARR12 [Cicer arietinum] Length = 633 Score = 65.9 bits (159), Expect = 8e-10 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYS 330 NNLGSLEYLV S MEQEQDKMKLL GDLICDNYS Sbjct: 599 NNLGSLEYLVSSTMEQEQDKMKLLNGDLICDNYS 632 >ACU18185.1 unknown [Glycine max] Length = 328 Score = 63.2 bits (152), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVS 318 NNLGSLE LV SMM+QE DKMKLL G+LIC+NYSGG+S Sbjct: 274 NNLGSLEDLVSSMMKQENDKMKLLDGNLICNNYSGGLS 311 >KHN07036.1 Two-component response regulator ARR12 [Glycine soja] Length = 647 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVS 318 NNLGSLE LV SMM+QE DKMKLL G+LIC+NYSGG+S Sbjct: 593 NNLGSLEDLVSSMMKQENDKMKLLDGNLICNNYSGGLS 630 >XP_003526216.1 PREDICTED: two-component response regulator ARR12 [Glycine max] KRH52361.1 hypothetical protein GLYMA_06G063500 [Glycine max] Length = 696 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVS 318 NNLGSLE LV SMM+QE DKMKLL G+LIC+NYSGG+S Sbjct: 642 NNLGSLEDLVSSMMKQENDKMKLLDGNLICNNYSGGLS 679 >XP_015945363.1 PREDICTED: two-component response regulator ARR10-like [Arachis duranensis] Length = 615 Score = 62.8 bits (151), Expect = 9e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NN+GSLE LV SMM+QEQD+MK+L G ICDNYSGG+S+ Sbjct: 577 NNVGSLEDLVSSMMKQEQDEMKILDGGFICDNYSGGISM 615 >XP_016180768.1 PREDICTED: two-component response regulator ARR12-like isoform X1 [Arachis ipaensis] Length = 650 Score = 62.8 bits (151), Expect = 9e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NN+GSLE LV SMM+QEQD+MK+L G ICDNYSGG+S+ Sbjct: 612 NNVGSLEDLVSSMMKQEQDEMKILDGGFICDNYSGGISM 650 >XP_019437783.1 PREDICTED: two-component response regulator ARR12-like isoform X2 [Lupinus angustifolius] Length = 639 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NNLGSLE V S+M+QEQD MKLL G+ ICDNYSGG+ + Sbjct: 601 NNLGSLEDFVNSVMKQEQDNMKLLDGNSICDNYSGGIPM 639 >XP_019437782.1 PREDICTED: two-component response regulator ARR12-like isoform X1 [Lupinus angustifolius] Length = 664 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 NNLGSLE V S+M+QEQD MKLL G+ ICDNYSGG+ + Sbjct: 626 NNLGSLEDFVNSVMKQEQDNMKLLDGNSICDNYSGGIPM 664 >XP_014501987.1 PREDICTED: two-component response regulator ORR24-like [Vigna radiata var. radiata] XP_014501989.1 PREDICTED: two-component response regulator ORR24-like [Vigna radiata var. radiata] Length = 670 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 +NLGSLE LV SMM+QE+D++KLL +LICDNY GG+S+ Sbjct: 632 SNLGSLEDLVSSMMKQEKDRLKLLDENLICDNYPGGLSM 670 >KOM42040.1 hypothetical protein LR48_Vigan04g223800 [Vigna angularis] Length = 669 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 +NLGSLE LV SMM+QE+D++KLL +L CDNY GG+S+ Sbjct: 631 SNLGSLEDLVSSMMKQEKDRLKLLDENLFCDNYPGGLSM 669 >XP_017422392.1 PREDICTED: two-component response regulator ARR12 [Vigna angularis] Length = 675 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 431 NNLGSLEYLVGSMMEQEQDKMKLLGGDLICDNYSGGVSL 315 +NLGSLE LV SMM+QE+D++KLL +L CDNY GG+S+ Sbjct: 637 SNLGSLEDLVSSMMKQEKDRLKLLDENLFCDNYPGGLSM 675