BLASTX nr result
ID: Glycyrrhiza32_contig00032912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032912 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB11748.1 hypothetical protein B456_001G2756001, partial [Gossy... 55 5e-08 AIA58699.1 inducer of CBF expression 2, partial [Vitis riparia] 55 6e-08 ACJ39216.1 inducer of CBF expression 6 [Glycine max] 57 1e-07 XP_014623919.1 PREDICTED: transcription factor ICE1-like isoform... 57 4e-07 KOM38329.1 hypothetical protein LR48_Vigan03g171100 [Vigna angul... 57 4e-07 XP_007161631.1 hypothetical protein PHAVU_001G085500g [Phaseolus... 57 4e-07 XP_017419478.1 PREDICTED: transcription factor ICE1-like isoform... 57 4e-07 XP_014498308.1 PREDICTED: transcription factor ICE1-like isoform... 57 4e-07 NP_001241268.1 transcription factor ICE1-like [Glycine max] ADV3... 57 4e-07 OAY52548.1 hypothetical protein MANES_04G092400 [Manihot esculenta] 57 4e-07 KHN13386.1 Transcription factor ICE1 [Glycine soja] 56 4e-07 NP_001241335.1 uncharacterized protein LOC100805320 [Glycine max... 56 5e-07 KRH08406.1 hypothetical protein GLYMA_16G147200 [Glycine max] 56 6e-07 CBI21285.3 unnamed protein product, partial [Vitis vinifera] 55 1e-06 EEF49354.1 conserved hypothetical protein [Ricinus communis] 55 1e-06 AGP04217.1 inducer of CBF expression 1 [Vitis amurensis] 55 1e-06 AIA58701.1 inducer of CBF expression 2 [Vitis riparia] AIA58705.... 55 1e-06 AGQ03810.1 inducer of CBF expression 1a [Vitis vinifera] 55 1e-06 AGP04218.1 inducer of CBF expression 2 [Vitis amurensis] 55 1e-06 XP_015570780.1 PREDICTED: transcription factor ICE1 [Ricinus com... 55 1e-06 >KJB11748.1 hypothetical protein B456_001G2756001, partial [Gossypium raimondii] KJB11749.1 hypothetical protein B456_001G2756001, partial [Gossypium raimondii] Length = 64 Score = 55.1 bits (131), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHG+M Sbjct: 36 AEQCREGQDVLPEQIKAVLLD-SAGFHGIM 64 >AIA58699.1 inducer of CBF expression 2, partial [Vitis riparia] Length = 83 Score = 55.5 bits (132), Expect = 6e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 55 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 83 >ACJ39216.1 inducer of CBF expression 6 [Glycine max] Length = 160 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 132 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 160 >XP_014623919.1 PREDICTED: transcription factor ICE1-like isoform X1 [Glycine max] Length = 374 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 346 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 374 >KOM38329.1 hypothetical protein LR48_Vigan03g171100 [Vigna angularis] Length = 391 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 363 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 391 >XP_007161631.1 hypothetical protein PHAVU_001G085500g [Phaseolus vulgaris] ESW33625.1 hypothetical protein PHAVU_001G085500g [Phaseolus vulgaris] Length = 427 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 399 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 427 >XP_017419478.1 PREDICTED: transcription factor ICE1-like isoform X2 [Vigna angularis] BAT84727.1 hypothetical protein VIGAN_04216900 [Vigna angularis var. angularis] Length = 434 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 406 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 434 >XP_014498308.1 PREDICTED: transcription factor ICE1-like isoform X2 [Vigna radiata var. radiata] Length = 434 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 406 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 434 >NP_001241268.1 transcription factor ICE1-like [Glycine max] ADV36252.1 ICEa [Glycine max] KRH06841.1 hypothetical protein GLYMA_16G049400 [Glycine max] Length = 450 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 422 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 450 >OAY52548.1 hypothetical protein MANES_04G092400 [Manihot esculenta] Length = 530 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGMM Sbjct: 502 AEQCREGQDVLPEQIKAVLLD-SAGFHGMM 530 >KHN13386.1 Transcription factor ICE1 [Glycine soja] Length = 276 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIK VLLD TAGFHGMM Sbjct: 248 AEQCREGQDVLPEQIKEVLLD-TAGFHGMM 276 >NP_001241335.1 uncharacterized protein LOC100805320 [Glycine max] ADV36255.1 ICEe [Glycine max] Length = 409 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIK VLLD TAGFHGMM Sbjct: 381 AEQCREGQDVLPEQIKEVLLD-TAGFHGMM 409 >KRH08406.1 hypothetical protein GLYMA_16G147200 [Glycine max] Length = 444 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIK VLLD TAGFHGMM Sbjct: 416 AEQCREGQDVLPEQIKEVLLD-TAGFHGMM 444 >CBI21285.3 unnamed protein product, partial [Vitis vinifera] Length = 340 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 312 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 340 >EEF49354.1 conserved hypothetical protein [Ricinus communis] Length = 428 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHG+M Sbjct: 400 AEQCREGQDVLPEQIKAVLLD-SAGFHGLM 428 >AGP04217.1 inducer of CBF expression 1 [Vitis amurensis] Length = 516 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 488 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 516 >AIA58701.1 inducer of CBF expression 2 [Vitis riparia] AIA58705.1 inducer of CBF expression 2 [Vitis riparia] Length = 538 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 510 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 538 >AGQ03810.1 inducer of CBF expression 1a [Vitis vinifera] Length = 538 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 510 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 538 >AGP04218.1 inducer of CBF expression 2 [Vitis amurensis] Length = 538 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHGM+ Sbjct: 510 AEQCREGQDVLPEQIKAVLLD-SAGFHGML 538 >XP_015570780.1 PREDICTED: transcription factor ICE1 [Ricinus communis] Length = 560 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 321 AEQCREGQDVLPEQIKAVLLDTTAGFHGMM 232 AEQCREGQDVLPEQIKAVLLD +AGFHG+M Sbjct: 532 AEQCREGQDVLPEQIKAVLLD-SAGFHGLM 560