BLASTX nr result
ID: Glycyrrhiza32_contig00032647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032647 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75608.1 hypothetical protein KK1_019799 [Cajanus cajan] 158 7e-44 OIW07641.1 hypothetical protein TanjilG_03749 [Lupinus angustifo... 158 1e-43 XP_014620508.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 2e-43 XP_003539494.2 PREDICTED: pentatricopeptide repeat-containing pr... 158 2e-43 XP_019450698.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 5e-43 XP_004510607.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 4e-42 XP_014502411.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 5e-42 XP_014502410.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 5e-42 GAU46272.1 hypothetical protein TSUD_174480 [Trifolium subterran... 148 6e-42 XP_007138408.1 hypothetical protein PHAVU_009G206300g [Phaseolus... 154 7e-42 XP_016184237.1 PREDICTED: pentatricopeptide repeat-containing pr... 153 1e-41 XP_016186147.1 PREDICTED: pentatricopeptide repeat-containing pr... 153 2e-41 KOM40018.1 hypothetical protein LR48_Vigan04g021600 [Vigna angul... 152 2e-41 XP_017419933.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 2e-41 XP_015950719.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 6e-40 XP_016197697.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 8e-40 XP_015959229.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 2e-39 XP_003622527.1 PPR containing plant-like protein [Medicago trunc... 145 7e-39 XP_008444214.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 2e-35 XP_004142707.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 1e-34 >KYP75608.1 hypothetical protein KK1_019799 [Cajanus cajan] Length = 606 Score = 158 bits (400), Expect = 7e-44 Identities = 77/89 (86%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAEML DELFEKEILL GSKPLAASY IFQ+LCE+GKTKKAERVIRQLMRRGTQD Sbjct: 300 YDMAEMLFDELFEKEILLSKFGSKPLAASYSLIFQFLCENGKTKKAERVIRQLMRRGTQD 359 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVIMGHCKEGAYE G+ELLVWMLR Sbjct: 360 PQSYQTVIMGHCKEGAYERGYELLVWMLR 388 >OIW07641.1 hypothetical protein TanjilG_03749 [Lupinus angustifolius] Length = 626 Score = 158 bits (399), Expect = 1e-43 Identities = 74/89 (83%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DELFEKEIL++N GSKPLAA+Y PIFQYLCEHGKT KAERV+RQLMRRGTQD Sbjct: 310 YDTAEKLFDELFEKEILINNFGSKPLAAAYSPIFQYLCEHGKTNKAERVLRQLMRRGTQD 369 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY TVIMGHCKEGAYENG+ELLVWM+R Sbjct: 370 ALSYKTVIMGHCKEGAYENGYELLVWMIR 398 >XP_014620508.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X2 [Glycine max] Length = 732 Score = 158 bits (400), Expect = 2e-43 Identities = 75/89 (84%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE L DELFEKEILL GSKPLAASY PIF+ LCEHGKTKKAERVIRQLM+RGTQD Sbjct: 413 YDMAEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHGKTKKAERVIRQLMKRGTQD 472 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVIMGHCKEGAYE+G+ELL+WMLR Sbjct: 473 PQSYTTVIMGHCKEGAYESGYELLMWMLR 501 >XP_003539494.2 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X1 [Glycine max] XP_014620507.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X1 [Glycine max] KRH26747.1 hypothetical protein GLYMA_12G191600 [Glycine max] Length = 741 Score = 158 bits (400), Expect = 2e-43 Identities = 75/89 (84%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE L DELFEKEILL GSKPLAASY PIF+ LCEHGKTKKAERVIRQLM+RGTQD Sbjct: 413 YDMAEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHGKTKKAERVIRQLMKRGTQD 472 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVIMGHCKEGAYE+G+ELL+WMLR Sbjct: 473 PQSYTTVIMGHCKEGAYESGYELLMWMLR 501 >XP_019450698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Lupinus angustifolius] Length = 1141 Score = 158 bits (399), Expect = 5e-43 Identities = 74/89 (83%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DELFEKEIL++N GSKPLAA+Y PIFQYLCEHGKT KAERV+RQLMRRGTQD Sbjct: 424 YDTAEKLFDELFEKEILINNFGSKPLAAAYSPIFQYLCEHGKTNKAERVLRQLMRRGTQD 483 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY TVIMGHCKEGAYENG+ELLVWM+R Sbjct: 484 ALSYKTVIMGHCKEGAYENGYELLVWMIR 512 >XP_004510607.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cicer arietinum] Length = 740 Score = 155 bits (391), Expect = 4e-42 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AEML DELFE EILL + G KPLAASY+ IFQYLCEHGKTKKAERV+RQLM+RGTQD Sbjct: 424 YDKAEMLFDELFENEILLRSSGPKPLAASYKRIFQYLCEHGKTKKAERVLRQLMKRGTQD 483 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVI+GHCKEGA+ENG+ELL+WMLR Sbjct: 484 PLSYKTVILGHCKEGAFENGYELLIWMLR 512 >XP_014502411.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X2 [Vigna radiata var. radiata] Length = 728 Score = 154 bits (390), Expect = 5e-42 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE+L DELFEKEILL N GSKPLAASY P+ QYLCEHGK+KKAERV+RQLM+RGTQD Sbjct: 412 YDMAEVLFDELFEKEILLSNFGSKPLAASYSPLIQYLCEHGKSKKAERVMRQLMKRGTQD 471 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 YNT+IMGHCKEG YE+G+ELLVWMLR Sbjct: 472 GQLYNTLIMGHCKEGTYESGYELLVWMLR 500 >XP_014502410.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Vigna radiata var. radiata] Length = 733 Score = 154 bits (390), Expect = 5e-42 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE+L DELFEKEILL N GSKPLAASY P+ QYLCEHGK+KKAERV+RQLM+RGTQD Sbjct: 417 YDMAEVLFDELFEKEILLSNFGSKPLAASYSPLIQYLCEHGKSKKAERVMRQLMKRGTQD 476 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 YNT+IMGHCKEG YE+G+ELLVWMLR Sbjct: 477 GQLYNTLIMGHCKEGTYESGYELLVWMLR 505 >GAU46272.1 hypothetical protein TSUD_174480 [Trifolium subterraneum] Length = 342 Score = 148 bits (374), Expect = 6e-42 Identities = 69/89 (77%), Positives = 79/89 (88%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE LLDELFEKEILL + G KPLAASYR IF+YLCEHGKTKKAER++RQLM+RGTQD Sbjct: 26 YDKAERLLDELFEKEILLRDYGPKPLAASYRCIFRYLCEHGKTKKAERLLRQLMKRGTQD 85 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY VI+GHCK+GA+ENG+ LL+WMLR Sbjct: 86 PLSYKIVILGHCKDGAFENGYGLLIWMLR 114 >XP_007138408.1 hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris] ESW10402.1 hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris] Length = 728 Score = 154 bits (389), Expect = 7e-42 Identities = 71/89 (79%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE+L DELFEKEILL N GSKPL A+Y P+FQYLCEHGK+KKAERV+RQLM+RGTQD Sbjct: 412 YDMAELLFDELFEKEILLCNFGSKPLVAAYSPLFQYLCEHGKSKKAERVMRQLMKRGTQD 471 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY T+IMGHCKEGAYE+G+E LVWMLR Sbjct: 472 AQSYKTLIMGHCKEGAYESGYEFLVWMLR 500 >XP_016184237.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184238.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016184240.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184241.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184242.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 725 Score = 153 bits (387), Expect = 1e-41 Identities = 71/89 (79%), Positives = 78/89 (87%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DEL+E E LL N GSKP+AASY PIFQYLCEHGKTKKAE+V+RQLM+RGTQD Sbjct: 427 YDAAEKLFDELYENETLLSNYGSKPIAASYSPIFQYLCEHGKTKKAEKVLRQLMKRGTQD 486 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVIMGHCKEGAYENG+ +LVWMLR Sbjct: 487 PLSYKTVIMGHCKEGAYENGYGILVWMLR 515 >XP_016186147.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] Length = 793 Score = 153 bits (387), Expect = 2e-41 Identities = 71/89 (79%), Positives = 78/89 (87%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DEL+E E LL N GSKP+AASY PIFQYLCEHGKTKKAE+V+RQLM+RGTQD Sbjct: 495 YDAAEKLFDELYENETLLSNYGSKPIAASYSPIFQYLCEHGKTKKAEKVLRQLMKRGTQD 554 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY TVIMGHCKEGAYENG+ +LVWMLR Sbjct: 555 PLSYKTVIMGHCKEGAYENGYGILVWMLR 583 >KOM40018.1 hypothetical protein LR48_Vigan04g021600 [Vigna angularis] Length = 667 Score = 152 bits (385), Expect = 2e-41 Identities = 71/89 (79%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE+L DELFEKEILL N GS PLAA+Y P+ QYLCEHGK+KKAERV+RQLM+RGTQD Sbjct: 359 YDMAEVLFDELFEKEILLSNFGSMPLAAAYSPLIQYLCEHGKSKKAERVMRQLMKRGTQD 418 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 YNT+IMGHCKEGAYE+G+ELLVWMLR Sbjct: 419 GQLYNTLIMGHCKEGAYESGYELLVWMLR 447 >XP_017419933.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Vigna angularis] BAT79845.1 hypothetical protein VIGAN_02278500 [Vigna angularis var. angularis] Length = 725 Score = 152 bits (385), Expect = 2e-41 Identities = 71/89 (79%), Positives = 80/89 (89%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YDMAE+L DELFEKEILL N GS PLAA+Y P+ QYLCEHGK+KKAERV+RQLM+RGTQD Sbjct: 417 YDMAEVLFDELFEKEILLSNFGSMPLAAAYSPLIQYLCEHGKSKKAERVMRQLMKRGTQD 476 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 YNT+IMGHCKEGAYE+G+ELLVWMLR Sbjct: 477 GQLYNTLIMGHCKEGAYESGYELLVWMLR 505 >XP_015950719.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015950721.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] Length = 726 Score = 149 bits (375), Expect = 6e-40 Identities = 69/89 (77%), Positives = 77/89 (86%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DEL+E E LL N GSKP+AASY PIFQYLCEHGKTKKAE+++RQLM+RGTQD Sbjct: 427 YDAAEKLFDELYENETLLSNYGSKPIAASYSPIFQYLCEHGKTKKAEKLLRQLMKRGTQD 486 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY TVIMGHCKEGAYENG+ +LVWMLR Sbjct: 487 HLSYKTVIMGHCKEGAYENGYGILVWMLR 515 >XP_016197697.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197699.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197700.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] Length = 736 Score = 148 bits (374), Expect = 8e-40 Identities = 69/89 (77%), Positives = 77/89 (86%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DEL+E E LL N GSKP+AASY PIFQYLCEHGK+KKAE+V+RQLM+RGTQD Sbjct: 437 YDAAEKLFDELYENETLLSNYGSKPIAASYSPIFQYLCEHGKSKKAEKVLRQLMKRGTQD 496 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY TVIMGHCKEGAYENG+ +LVWMLR Sbjct: 497 HLSYKTVIMGHCKEGAYENGYGILVWMLR 525 >XP_015959229.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015959230.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015959231.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] Length = 735 Score = 147 bits (371), Expect = 2e-39 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 YD AE L DEL+E E LL N GSKP+AASY PIFQYLCEHGKTKKAE+++RQLM+RGTQD Sbjct: 437 YDAAEKLFDELYENETLLSNYGSKPIAASYSPIFQYLCEHGKTKKAEKLLRQLMKRGTQD 496 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 SY TVIMGHCKEG YENG+ +LVWMLR Sbjct: 497 HLSYKTVIMGHCKEGGYENGYGILVWMLR 525 >XP_003622527.1 PPR containing plant-like protein [Medicago truncatula] AES78745.1 PPR containing plant-like protein [Medicago truncatula] Length = 721 Score = 145 bits (367), Expect = 7e-39 Identities = 69/89 (77%), Positives = 78/89 (87%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 Y AEML DELFEKEILL + G KPLAASY+ +FQYLCE+GKTKKAERV+RQLM+RGTQD Sbjct: 420 YGKAEMLFDELFEKEILLSSYGPKPLAASYKCMFQYLCENGKTKKAERVLRQLMKRGTQD 479 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 P SY VI+GHCKEG+YENG+ LLVWMLR Sbjct: 480 PLSYQIVILGHCKEGSYENGYGLLVWMLR 508 >XP_008444214.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cucumis melo] XP_008444216.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cucumis melo] Length = 757 Score = 136 bits (342), Expect = 2e-35 Identities = 64/89 (71%), Positives = 76/89 (85%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 Y+ AE LLD+L E++ILL + KPL ASY PIF+YLCE+GKTKKAE+V RQLMRRGTQD Sbjct: 414 YEKAEDLLDKLLERKILLSDDSCKPLVASYNPIFKYLCENGKTKKAEKVFRQLMRRGTQD 473 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 PPSY T+IMGHCKEG +E+G+ELLV MLR Sbjct: 474 PPSYKTLIMGHCKEGTFESGYELLVLMLR 502 >XP_004142707.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cucumis sativus] XP_011653773.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cucumis sativus] KGN54533.1 hypothetical protein Csa_4G358710 [Cucumis sativus] Length = 757 Score = 134 bits (337), Expect = 1e-34 Identities = 63/89 (70%), Positives = 74/89 (83%) Frame = +2 Query: 2 YDMAEMLLDELFEKEILLHNVGSKPLAASYRPIFQYLCEHGKTKKAERVIRQLMRRGTQD 181 Y+ AE LLD+L E++ILL G KPL A+Y PIF+YLCE GKTKKAE+ RQLMRRGTQD Sbjct: 414 YEKAEDLLDKLLERKILLSGDGCKPLVAAYNPIFKYLCETGKTKKAEKAFRQLMRRGTQD 473 Query: 182 PPSYNTVIMGHCKEGAYENGFELLVWMLR 268 PPSY T+IMGHCKEG +E+G+ELLV MLR Sbjct: 474 PPSYKTLIMGHCKEGTFESGYELLVLMLR 502