BLASTX nr result
ID: Glycyrrhiza32_contig00032603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032603 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 4e-08 XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago ... 54 7e-07 >XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Cicer arietinum] Length = 813 Score = 57.8 bits (138), Expect = 4e-08 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +2 Query: 80 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNG-DPNAGKRVHC 208 HI HQ CL ALDSHSYAHMLQQ IRNG DPNAGK++HC Sbjct: 22 HIQHQ-HQPCL---VALDSHSYAHMLQQIIRNGADPNAGKQLHC 61 >XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AET00767.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 811 Score = 54.3 bits (129), Expect = 7e-07 Identities = 30/44 (68%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 80 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNG-DPNAGKRVHC 208 +IHHQ CL ALDSHSYAHMLQQ IRNG DP AGK +HC Sbjct: 22 NIHHQQ---CLS---ALDSHSYAHMLQQIIRNGADPIAGKHLHC 59