BLASTX nr result
ID: Glycyrrhiza32_contig00032517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032517 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003597095.1 transmembrane protein, putative [Medicago truncat... 54 1e-07 XP_003612252.1 transmembrane protein, putative [Medicago truncat... 53 2e-07 XP_003625333.1 transmembrane protein, putative [Medicago truncat... 53 2e-07 XP_003619149.1 transmembrane protein, putative [Medicago truncat... 52 6e-07 XP_003615404.1 transmembrane protein, putative [Medicago truncat... 52 6e-07 XP_003621867.1 transmembrane protein, putative [Medicago truncat... 52 7e-07 XP_003620155.1 transmembrane protein, putative [Medicago truncat... 52 7e-07 XP_003609362.1 transmembrane protein, putative [Medicago truncat... 52 7e-07 XP_003602827.1 transmembrane protein, putative [Medicago truncat... 51 1e-06 XP_003606212.1 transmembrane protein, putative [Medicago truncat... 51 1e-06 XP_003590939.1 transmembrane protein, putative [Medicago truncat... 51 1e-06 XP_013449112.1 hypothetical protein MTR_7g066950 [Medicago trunc... 52 1e-06 XP_003626545.1 transmembrane protein, putative [Medicago truncat... 50 2e-06 XP_003599373.1 transmembrane protein, putative [Medicago truncat... 50 2e-06 XP_003629115.1 transmembrane protein, putative [Medicago truncat... 50 4e-06 XP_003606514.1 transmembrane protein, putative [Medicago truncat... 49 7e-06 >XP_003597095.1 transmembrane protein, putative [Medicago truncatula] AES67346.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 53.5 bits (127), Expect = 1e-07 Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 M WA TLQ R+H Y G +++ FVGILP +AI NLG ASLFAD PF+ ++ Sbjct: 1 MTWASTLQIRKHGYFGDLNFIILFVGILPSYAI---------NLGDASLFADSPFMFLAM 51 Query: 41 VEF 33 F Sbjct: 52 FVF 54 >XP_003612252.1 transmembrane protein, putative [Medicago truncatula] AES95210.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 53.1 bits (126), Expect = 2e-07 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+HRY G ++ FVGI P +AINLG SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHRYFGDLSFIILFVGIFP---------LYAINLGVLSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_003625333.1 transmembrane protein, putative [Medicago truncatula] AES81551.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 53.1 bits (126), Expect = 2e-07 Identities = 33/68 (48%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+H Y G ++ FVGILP +AINLGA SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHGYFGDLGFIILFVGILP---------LYAINLGAMSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_003619149.1 transmembrane protein, putative [Medicago truncatula] AES75367.1 transmembrane protein, putative [Medicago truncatula] Length = 65 Score = 52.0 bits (123), Expect = 6e-07 Identities = 31/70 (44%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIWA TLQ +++ Y G D++ FVGILP +AINL A SLFAD + VFS Sbjct: 1 MIWASTLQIQKNVYFGDLDFIILFVGILP---------LYAINLDAVSLFADSLYYVFSD 51 Query: 41 VEFVLFRCIF 12 + V+ +F Sbjct: 52 INHVIVSDVF 61 >XP_003615404.1 transmembrane protein, putative [Medicago truncatula] AES98362.1 transmembrane protein, putative [Medicago truncatula] Length = 66 Score = 52.0 bits (123), Expect = 6e-07 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIWA TLQ ++H Y G D++ FV I P +AINLGA SLFAD P+ +I Sbjct: 1 MIWASTLQIQKHGYFGDLDFIILFVDIFP---------LYAINLGAVSLFADSPYTFLAI 51 Query: 41 VEFVLFRCIFL 9 + +L F+ Sbjct: 52 LIMLLSLMYFI 62 >XP_003621867.1 transmembrane protein, putative [Medicago truncatula] AES78085.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 51.6 bits (122), Expect = 7e-07 Identities = 31/68 (45%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R H Y G ++ F+GILP +AINLGA SLFAD PF ++ Sbjct: 1 MIWTSTLQIRNHEYFGDLGFIILFIGILP---------LYAINLGAVSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V L+R Sbjct: 52 FVSDALYR 59 >XP_003620155.1 transmembrane protein, putative [Medicago truncatula] AES76373.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 51.6 bits (122), Expect = 7e-07 Identities = 27/62 (43%), Positives = 33/62 (53%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVSFVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSIV 39 MIWA TLQ R+H Y G D++ VGI L +AINLG SLF D P ++ Sbjct: 1 MIWASTLQIRKHGYFGDLDFI--------ILFVGISLLYAINLGVVSLFTDSPITFLAMF 52 Query: 38 EF 33 F Sbjct: 53 VF 54 >XP_003609362.1 transmembrane protein, putative [Medicago truncatula] AES91559.1 transmembrane protein, putative [Medicago truncatula] Length = 62 Score = 51.6 bits (122), Expect = 7e-07 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ ++ YSG DY+ FVGILP +AINLGA SLFAD F +I Sbjct: 1 MIWTSTLQIQKQEYSGDLDYIILFVGILP---------LYAINLGAVSLFADSFFTFLAI 51 Query: 41 V 39 + Sbjct: 52 L 52 >XP_003602827.1 transmembrane protein, putative [Medicago truncatula] AES73078.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 51.2 bits (121), Expect = 1e-06 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+H Y G ++ FVGILP +AINLG SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHGYLGDLGFIILFVGILP---------LYAINLGDVSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_003606212.1 transmembrane protein, putative [Medicago truncatula] AES88409.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 51.2 bits (121), Expect = 1e-06 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+H Y G ++ F+GILP +AINLG SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHGYFGDLSFIILFLGILP---------LYAINLGVVSLFADSPFTFLTM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_003590939.1 transmembrane protein, putative [Medicago truncatula] AES61190.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 51.2 bits (121), Expect = 1e-06 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+H Y G + ++ FV ILP +AINLG SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHGYFGDFGFIILFVSILP---------LYAINLGVVSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_013449112.1 hypothetical protein MTR_7g066950 [Medicago truncatula] KEH23139.1 hypothetical protein MTR_7g066950 [Medicago truncatula] Length = 111 Score = 52.4 bits (124), Expect = 1e-06 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 5/94 (5%) Frame = -1 Query: 272 VFVCFRLADMLRPSTNSQMIW-----APTLQTRRHRYSGQYDYVSFVGILPRFAIVGIML 108 VF FRL+D LR S +S + A TLQ R+H YSG + V GI + Sbjct: 27 VFDRFRLSDQLRSSADSINDFGVIHVASTLQIRKHGYSGDLNIVICEGICT-------LP 79 Query: 107 CFAINLGAASLFADLPFLVFSIVEFVLFRCIFLI 6 +AIN+ SLF D F +FS EF L+RC I Sbjct: 80 FYAINMDVVSLFTDSSFFIFS--EFALYRCTLSI 111 >XP_003626545.1 transmembrane protein, putative [Medicago truncatula] AES82763.1 transmembrane protein, putative [Medicago truncatula] Length = 60 Score = 50.4 bits (119), Expect = 2e-06 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVSFVGILPRFAIVGIMLCFAINLGAASLFADLPF 57 MIW TLQ R+H Y G ++ VGI+ +AINLGA SLFAD PF Sbjct: 1 MIWTSTLQIRKHGYFGDLGFI--------ILFVGILSLYAINLGAVSLFADSPF 46 >XP_003599373.1 transmembrane protein, putative [Medicago truncatula] AES69624.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 50.4 bits (119), Expect = 2e-06 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ ++H Y G ++ FVGILP +AINLGA SLF D PF ++ Sbjct: 1 MIWTITLQIQKHDYFGDLSFIILFVGILP---------LYAINLGAVSLFVDSPFTFLAM 51 Query: 41 VEF-VLFR 21 F +L+R Sbjct: 52 FVFDILYR 59 >XP_003629115.1 transmembrane protein, putative [Medicago truncatula] AET03591.1 transmembrane protein, putative [Medicago truncatula] Length = 61 Score = 49.7 bits (117), Expect = 4e-06 Identities = 31/68 (45%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPFLVFSI 42 MIW TLQ R+H Y ++ FVGILP +AINLG SLFAD PF ++ Sbjct: 1 MIWTSTLQIRKHVYFSDLSFIILFVGILP---------LYAINLGVVSLFADSPFTFLAM 51 Query: 41 -VEFVLFR 21 V VL+R Sbjct: 52 FVSDVLYR 59 >XP_003606514.1 transmembrane protein, putative [Medicago truncatula] AES88711.1 transmembrane protein, putative [Medicago truncatula] Length = 56 Score = 48.9 bits (115), Expect = 7e-06 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -1 Query: 218 MIWAPTLQTRRHRYSGQYDYVS-FVGILPRFAIVGIMLCFAINLGAASLFADLPF 57 MIW TLQ R+H Y G ++ FVGILP + I LGA SLFAD PF Sbjct: 1 MIWTSTLQIRKHEYFGDLSFIILFVGILP---------LYGIKLGAVSLFADSPF 46