BLASTX nr result
ID: Glycyrrhiza32_contig00032474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00032474 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007158378.1 hypothetical protein PHAVU_002G148100g [Phaseolus... 75 3e-14 XP_014520923.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 75 3e-14 XP_003519843.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 75 3e-14 XP_014620339.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 75 3e-14 KYP66325.1 Ubiquitin carboxyl-terminal hydrolase 17 [Cajanus cajan] 74 1e-13 XP_017406608.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 73 2e-13 BAT99466.1 hypothetical protein VIGAN_10091200 [Vigna angularis ... 73 2e-13 KOM26541.1 hypothetical protein LR48_Vigan284s002700 [Vigna angu... 73 2e-13 KHN14516.1 Ubiquitin carboxyl-terminal hydrolase 17 [Glycine soja] 61 2e-09 XP_014624685.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 2e-09 XP_003613074.2 ubiquitin carboxy-terminal hydrolase [Medicago tr... 61 3e-09 GAU23336.1 hypothetical protein TSUD_237900 [Trifolium subterran... 59 2e-08 XP_015963370.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 58 3e-08 XP_016201047.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 58 3e-08 XP_012568201.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 54 8e-07 >XP_007158378.1 hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris] ESW30372.1 hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris] Length = 925 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK SGVHVRRTS DASAQTFY Sbjct: 888 SGSRGIDLKRYITANHYDKNSGVHVRRTSGDASAQTFY 925 >XP_014520923.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Vigna radiata var. radiata] Length = 926 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK SGVHVRRTS DASAQTFY Sbjct: 889 SGSRGIDLKRYITANHYDKNSGVHVRRTSGDASAQTFY 926 >XP_003519843.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform X2 [Glycine max] KRH69660.1 hypothetical protein GLYMA_02G040900 [Glycine max] Length = 938 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK SGVHVRRTS DASAQTFY Sbjct: 901 SGSRGIDLKRYITANHYDKKSGVHVRRTSGDASAQTFY 938 >XP_014620339.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform X1 [Glycine max] Length = 950 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK SGVHVRRTS DASAQTFY Sbjct: 913 SGSRGIDLKRYITANHYDKKSGVHVRRTSGDASAQTFY 950 >KYP66325.1 Ubiquitin carboxyl-terminal hydrolase 17 [Cajanus cajan] Length = 576 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK SGVHVRRTS D SAQTFY Sbjct: 539 SGSRGIDLKRYITANHYDKKSGVHVRRTSGDTSAQTFY 576 >XP_017406608.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Vigna angularis] Length = 898 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK GVHVRRTS DASAQTFY Sbjct: 861 SGSRGIDLKRYITANHYDKNYGVHVRRTSGDASAQTFY 898 >BAT99466.1 hypothetical protein VIGAN_10091200 [Vigna angularis var. angularis] Length = 926 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK GVHVRRTS DASAQTFY Sbjct: 889 SGSRGIDLKRYITANHYDKNYGVHVRRTSGDASAQTFY 926 >KOM26541.1 hypothetical protein LR48_Vigan284s002700 [Vigna angularis] Length = 945 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSRG+DLKRY+TANHYDK GVHVRRTS DASAQTFY Sbjct: 908 SGSRGIDLKRYITANHYDKNYGVHVRRTSGDASAQTFY 945 >KHN14516.1 Ubiquitin carboxyl-terminal hydrolase 17 [Glycine soja] Length = 874 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADA 105 SGSRGVDLKRY+TANHYDK SGVHVRR S DA Sbjct: 843 SGSRGVDLKRYITANHYDKNSGVHVRRISGDA 874 >XP_014624685.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Glycine max] KRH74502.1 hypothetical protein GLYMA_01G023900 [Glycine max] Length = 927 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADA 105 SGSRGVDLKRY+TANHYDK SGVHVRR S DA Sbjct: 896 SGSRGVDLKRYITANHYDKNSGVHVRRISGDA 927 >XP_003613074.2 ubiquitin carboxy-terminal hydrolase [Medicago truncatula] AES96032.2 ubiquitin carboxy-terminal hydrolase [Medicago truncatula] Length = 943 Score = 60.8 bits (146), Expect = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SG G+DLK++VTA H+DK S VHVRRTS DASAQTFY Sbjct: 906 SGRWGIDLKKFVTAKHHDKSSAVHVRRTSRDASAQTFY 943 >GAU23336.1 hypothetical protein TSUD_237900 [Trifolium subterraneum] Length = 973 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SG G+DLKR+VT+ H+DK S VHVR+TS DASAQTFY Sbjct: 936 SGRWGIDLKRFVTSKHHDKSSVVHVRKTSRDASAQTFY 973 >XP_015963370.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Arachis duranensis] Length = 933 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSR DLKR+VT NH DK S HV+RTS DASAQTFY Sbjct: 896 SGSRVFDLKRFVTINHRDKSSSTHVKRTSRDASAQTFY 933 >XP_016201047.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Arachis ipaensis] Length = 934 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 200 SGSRGVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 SGSR DLKR+VT NH DK S HV+RTS DASAQTFY Sbjct: 897 SGSRVFDLKRFVTINHRDKSSSTHVKRTSRDASAQTFY 934 >XP_012568201.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Cicer arietinum] Length = 935 Score = 53.9 bits (128), Expect = 8e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 188 GVDLKRYVTANHYDKYSGVHVRRTSADASAQTFY 87 G+DLKRYVTA ++DK S V+VRRTS D+SAQTFY Sbjct: 902 GIDLKRYVTAKNHDKNSVVNVRRTSTDSSAQTFY 935